BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0088 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 27 0.15 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 5.8 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 7.6 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 27.1 bits (57), Expect = 0.15 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 242 RIFKKSPEGNGDMPIETVKVVGLRKVP-GQPLGLTVTTDEHGQLIV 376 RI ++ G+ + P ETV ++ +VP G P + V T++ L+V Sbjct: 970 RIVAENEIGSSE-PSETVTIITAEEVPGGPPTSIRVETNDQHSLVV 1014 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 5.8 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 413 ALVSVGDVLLEVDGVHIESKEQPEGSCCKTQ*RVTLKVGL 532 +L+ + L E++ +I+ G+ CK Q TLK+G+ Sbjct: 532 SLLGAANQLEELNLKNIDLTVLESGAFCKMQPLRTLKIGV 571 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -2 Query: 253 FENSIRSGNSFGINLSSIPDP 191 F N + + +FGI ++S+ +P Sbjct: 134 FSNDVIATAAFGIRVNSVQEP 154 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 325 SWYFSKTYNFYCFYRHIAVTLGTLF 251 ++YF F FY H A TL T++ Sbjct: 296 NFYFIIFQVFESFYLHKATTLETVY 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,613 Number of Sequences: 336 Number of extensions: 4076 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -