BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0088 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 ... 30 1.8 At5g19180.1 68418.m02284 ubiquitin activating enzyme, putative (... 27 9.5 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 27 9.5 >At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 subunit-related contains similarity to Swiss-Prot:P80387 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb) (40 kDa subunit) [Sus scrofa] Length = 591 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 326 QPLGLTVTTDEHGQLIVARILAGSAAAKQALVSVGDVL 439 +PLG+ G++ V I GS A K ++ VGD L Sbjct: 83 KPLGIRFALSADGKIFVHAIKKGSNAEKARIIMVGDTL 120 >At5g19180.1 68418.m02284 ubiquitin activating enzyme, putative (ECR1) identical to putative ubiquitin activating enzyme E1 [Arabidopsis thaliana] GI:2952433; similar to NEDD8 activating enzyme [Mus musculus] GI:17061821 Length = 454 Score = 27.5 bits (58), Expect = 9.5 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Frame = -2 Query: 256 LFENSIRSGNSFGIN--LSSIPDPLSNQILP-IWS*ASINALKCALDTMIASSACSIVRI 86 +++ +IR FGI S+ + I+P I S +I + CAL+T+ SACS + Sbjct: 256 VYDEAIRRAELFGIPGVTYSLTQGVVKNIIPAIASTNAIISAACALETLKIVSACSKTLV 315 Query: 85 LFPRYS 68 + Y+ Sbjct: 316 NYLTYN 321 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = -2 Query: 127 DTMIASSACSIVRILFPRYSLSDLIMFTLPSDTGFTSR 14 +T++ ++AC +++ +FPR + +MF LP+ T R Sbjct: 2388 ETLLQTTACRVLQSVFPRKEIYYQVMF-LPNSVKDTMR 2424 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,428,247 Number of Sequences: 28952 Number of extensions: 349017 Number of successful extensions: 895 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 871 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -