BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0086 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0506 + 29613307-29613601,29613641-29613678,29613679-296138... 30 2.0 04_01_0102 + 1060539-1060657,1060752-1060904,1061478-1061728,106... 28 6.0 >02_05_0506 + 29613307-29613601,29613641-29613678,29613679-29613802, 29614358-29614484,29614915-29615002,29615539-29615631, 29616380-29616529 Length = 304 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 560 VVKRRPVNCNTTPIGRIGTGPPLERPRTVFFFF 462 V+ R NCN +GR PL RPR+ +F Sbjct: 130 VIDGRRANCNLASLGRAQPAVPLGRPRSAGSYF 162 >04_01_0102 + 1060539-1060657,1060752-1060904,1061478-1061728, 1061959-1062141,1062248-1062395,1062679-1062850, 1062971-1063105,1063210-1063356 Length = 435 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -1 Query: 677 ATLERRSVRAFFAIRQPGKRGMCCKAIKLGNRQGFP 570 A LE RAF + G G C +I LG R G P Sbjct: 364 APLENFRARAFSLLSIAGLSGFCQVSIPLGMRNGLP 399 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,895,236 Number of Sequences: 37544 Number of extensions: 260888 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -