BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0086 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 9e-17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 77 2e-14 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 76 3e-14 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 71 9e-13 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 66 3e-11 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 55 5e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 55 5e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 55 5e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 49 4e-06 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 48 5e-06 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 48 5e-06 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 48 5e-06 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 48 5e-06 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 48 5e-06 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 48 5e-06 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 48 5e-06 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 48 5e-06 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 48 5e-06 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 48 5e-06 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 48 5e-06 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 48 5e-06 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 48 5e-06 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 48 5e-06 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 48 5e-06 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 48 5e-06 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 48 5e-06 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 48 5e-06 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 48 5e-06 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 48 5e-06 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 48 5e-06 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 48 5e-06 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 48 5e-06 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 48 5e-06 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 48 5e-06 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 48 5e-06 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 48 5e-06 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 48 5e-06 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 48 5e-06 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 48 5e-06 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 48 5e-06 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 48 5e-06 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 48 5e-06 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 48 5e-06 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 48 5e-06 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 48 5e-06 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 48 5e-06 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46356| Best HMM Match : Adeno_VII (HMM E-Value=8) 48 5e-06 SB_46342| Best HMM Match : Secretin_N_2 (HMM E-Value=6.7) 48 5e-06 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 48 5e-06 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_45288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44667| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44607| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43888| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43792| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_43017| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 48 5e-06 SB_42818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42668| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42658| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42652| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42572| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42400| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_42250| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41999| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41852| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41807| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41675| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41363| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40979| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40426| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40206| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_39985| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_39620| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38461| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=6.5) 48 5e-06 SB_38310| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37918| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37627| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37251| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37090| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_36577| Best HMM Match : CC (HMM E-Value=7.9) 48 5e-06 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35083| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34588| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34053| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_34052| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33852| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33777| Best HMM Match : BTP (HMM E-Value=8.9) 48 5e-06 SB_33774| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33771| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33605| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33361| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33192| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_33060| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32479| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32421| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32220| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 48 5e-06 SB_31938| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31587| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_31495| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_30975| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_30661| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_30447| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_30018| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29560| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29205| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28658| Best HMM Match : I-set (HMM E-Value=1.5) 48 5e-06 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28406| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28215| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28209| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_27485| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_26011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 48 5e-06 SB_25260| Best HMM Match : PqiA (HMM E-Value=0.3) 48 5e-06 SB_25256| Best HMM Match : G-patch (HMM E-Value=3.7) 48 5e-06 SB_25128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 48 5e-06 SB_24116| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23634| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_23336| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_22975| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_22925| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_22609| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21773| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21563| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20892| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 48 5e-06 SB_20728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20637| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20345| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20175| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_20124| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19473| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19471| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19304| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_19023| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 48 5e-06 SB_18453| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18273| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18166| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_18032| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17618| Best HMM Match : Bombolitin (HMM E-Value=2.1e-07) 48 5e-06 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_17365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 48 5e-06 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16843| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16801| Best HMM Match : MSSP (HMM E-Value=0.31) 48 5e-06 SB_16735| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16611| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16365| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16176| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16128| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_16003| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15707| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15304| Best HMM Match : Herpes_UL49_5 (HMM E-Value=1.3) 48 5e-06 SB_15133| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_15036| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14889| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14619| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14400| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14226| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_14098| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 48 5e-06 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 48 5e-06 SB_13829| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13824| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13406| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13252| Best HMM Match : Ligase_CoA (HMM E-Value=9.1) 48 5e-06 SB_13028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 48 5e-06 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12650| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12577| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12301| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12180| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_11368| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_11136| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9824| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9660| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9352| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_9104| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8428| Best HMM Match : Glyco_hydro_2 (HMM E-Value=0.3) 48 5e-06 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 48 5e-06 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 84.2 bits (199), Expect = 9e-17 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -1 Query: 680 CATLERRSVRAFFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 CAT+ + FAI G+RGMCCKAIKLGN +GFPSHDVVKRRPVNCNTT Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTT 53 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 76.6 bits (180), Expect = 2e-14 Identities = 37/52 (71%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 677 ATLERRSVRA-FFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 A L RS+ A FAI G+RGMCCKAIKLGN +GFPSHD KRRPVNCNTT Sbjct: 41 AQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTT 92 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 76.6 bits (180), Expect = 2e-14 Identities = 37/52 (71%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 677 ATLERRSVRA-FFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 A L R++ A FAI G+RGMCCKAIKLGN FPSHDVVKRRPVNCNTT Sbjct: 10 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTT 61 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = -1 Query: 644 FAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 FAI G+RGMCCKAIKLGN FPSHDVVKRRPVNCNTT Sbjct: 8 FAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTT 47 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = -3 Query: 663 AIGPGLFRYTPAWQKGNVLQGN*VG*PPGFSQSRRCKTPASEL*YDPYRANW 508 AIG GLF TPA ++G + +G F K YRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 70.9 bits (166), Expect = 9e-13 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 677 ATLERRSVRA-FFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 A L R++ A FAI G+RGMCCK+IKL + FPSHDVVKRRPVNCNTT Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTT 55 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGKTL+VTQLN LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQ 50 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 66.1 bits (154), Expect = 3e-11 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 677 ATLERRSVRA-FFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 A L R++ A FAI G+RGMCCKAIKL FPSHDVVKRRPVNCNTT Sbjct: 1843 AQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPV-FPSHDVVKRRPVNCNTT 1893 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 65.7 bits (153), Expect = 3e-11 Identities = 32/52 (61%), Positives = 34/52 (65%) Frame = +3 Query: 516 PYRGRITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 P RITIHWPAFYN TGKTLA TQLN LAAH PFA S++ P Q Sbjct: 42 PIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQ 93 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 623 KRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 +RGMCCKAIKLGN F SHDVVKRRPVNCNTT Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTT 35 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 65.3 bits (152), Expect = 4e-11 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGK VTQLN LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 50 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 65.3 bits (152), Expect = 4e-11 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGK VTQLN LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 50 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.5 bits (150), Expect = 8e-11 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGK VTQLN LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 50 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGKTLA+ L LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQ 50 Score = 36.3 bits (80), Expect = 0.023 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = +1 Query: 571 GKPWRLPNLIALQHIPLLPGWRIAKKARTDRLSK 672 GK LPNLIAL P WR +++ARTDR S+ Sbjct: 17 GKTLALPNLIALAAHPPFASWRNSEEARTDRPSQ 50 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 62.1 bits (144), Expect = 4e-10 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +3 Query: 540 HWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 HWP+FYNVVTGKTL VTQLN LAAH PFA SE+ P Q Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 48 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 62.1 bits (144), Expect = 4e-10 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 2/56 (3%) Frame = -1 Query: 686 SGCATLERRSVRA-FFAIRQPGKRGMCCKA-IKLGNRQGFPSHDVVKRRPVNCNTT 525 S A L R++ A FAI G++G + +KLG RQGFPSHDVVKRRPVNCNTT Sbjct: 41 SQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTT 96 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 62.1 bits (144), Expect = 4e-10 Identities = 30/48 (62%), Positives = 32/48 (66%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNV+ KT VTQLN LAAH PFA SEK P Q Sbjct: 3 RITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQ 50 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 58.8 bits (136), Expect = 4e-09 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGKTLA+ L L H PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQ 50 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +1 Query: 571 GKPWRLPNLIALQHIPLLPGWRIAKKARTDRLSK 672 GK LPNLIALQ P WR +++ARTDR S+ Sbjct: 17 GKTLALPNLIALQLHPPFASWRNSEEARTDRPSQ 50 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 507 TNSPYRGRITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFA 626 +NSPY RITIHWP+FYNVVTGKTLA+ L L H P + Sbjct: 74 SNSPYMSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLS 112 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +1 Query: 571 GKPWRLPNLIALQHIPLLPGWRIAKKARTDRLSK 672 GK LPNLIALQHIPL P ++ARTDR S+ Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRPSQ 128 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVV + VTQLN LAAH PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 50 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 55.2 bits (127), Expect = 5e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -1 Query: 668 ERRSVRAFFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 E RSVRA +RQ K G C A +L GFPSHDVVKRRPVNCNTT Sbjct: 599 EGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKRRPVNCNTT 642 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 670 WKGDRSGPFSLYASLAKGECAARQLSW 590 W+G SL LAKG CAAR+LSW Sbjct: 598 WEGRSVRASSLLRQLAKGGCAARRLSW 624 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 55.2 bits (127), Expect = 5e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -1 Query: 668 ERRSVRAFFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 E RSVRA +RQ K G C A +L GFPSHDVVKRRPVNCNTT Sbjct: 42 EGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKRRPVNCNTT 85 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 670 WKGDRSGPFSLYASLAKGECAARQLSW 590 W+G SL LAKG CAAR+LSW Sbjct: 41 WEGRSVRASSLLRQLAKGGCAARRLSW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 55.2 bits (127), Expect = 5e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = -1 Query: 668 ERRSVRAFFAIRQPGKRGMCCKAIKLGNRQGFPSHDVVKRRPVNCNTT 525 E RSVRA +RQ K G C A +L GFPSHDVVKRRPVNCNTT Sbjct: 42 EGRSVRASSLLRQLAKGG--CAARRLS--WGFPSHDVVKRRPVNCNTT 85 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 670 WKGDRSGPFSLYASLAKGECAARQLSW 590 W+G SL LAKG CAAR+LSW Sbjct: 41 WEGRSVRASSLLRQLAKGGCAARRLSW 67 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.8 bits (126), Expect = 6e-08 Identities = 31/49 (63%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = -1 Query: 668 ERRSVRAFFAIRQPGKRGMCCKAIKLG-NRQGFPSHDVVKRRPVNCNTT 525 E RSVRA +RQ K G C A +L GFPSHDVVKRRPVNCNTT Sbjct: 28 EGRSVRASSLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTT 74 Score = 37.1 bits (82), Expect = 0.013 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 670 WKGDRSGPFSLYASLAKGECAARQLSWVT 584 W+G SL LAKG CAAR+LSWVT Sbjct: 27 WEGRSVRASSLLRQLAKGGCAARRLSWVT 55 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 RITIHWP+FYNVVTGKTLA+ L L PFA SE+ P Q Sbjct: 3 RITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQ 50 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +1 Query: 571 GKPWRLPNLIALQHIPLLPGWRIAKKARTDRLSK 672 GK LPNLIALQHIP WR +++ARTDR S+ Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRPSQ 50 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 1e-07 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = -3 Query: 669 GKAIGPGLFRYTPAWQKGNVLQGN*VG*PPGFSQSRRCKTPASEL 535 GK G RY +W+KG+VLQG PGFSQSRRCKT ASEL Sbjct: 6 GKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -2 Query: 679 AQLWKGDRSGPFSLYASLAKGECAARQLSWVT 584 A + KGDR GP YAS KG+ +LSWVT Sbjct: 3 ATVGKGDRCGPLRYYASWRKGDVLQGRLSWVT 34 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLAGVLQRRDWENPG Sbjct: 41 QFALYESYYNSLAGVLQRRDWENPG 65 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 66 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 94 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 52.0 bits (119), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLAGVLQRRDWENPG Sbjct: 54 QFALYESYYNSLAGVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 52.0 bits (119), Expect = 4e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -1 Query: 614 MCCKAIKLGNRQGFPSHDVVKRRPV 540 MCCKAIKLGN + FPSHDVVKRRPV Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV 25 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = -3 Query: 669 GKAIGPGLFRYTPAWQKGNVLQGN*VG*PPGFSQSRRCKTPASEL 535 GK G RY +W+KG+VLQ PGFSQSRRCKT ASEL Sbjct: 6 GKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -2 Query: 673 LWKGDRSGPFSLYASLAKGECAARQLSWVT 584 L KGDR GP YAS KG+ R+LSWVT Sbjct: 5 LGKGDRCGPLRYYASWRKGDVLQRRLSWVT 34 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = +3 Query: 528 RITIHWPAFYNVVTGKTLAVTQLNCLAAHSPFARLAYSEKGP 653 RITIHWP+FYNVVTGKTLA+ L L H P + K P Sbjct: 3 RITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRP 43 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +1 Query: 571 GKPWRLPNLIALQHIPLLPGWRIAKKARTDRLSK 672 GK LPNLIALQHIPL P IAK+ L K Sbjct: 17 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALPK 50 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPG 48 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 49 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 77 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPG 75 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 104 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPG 83 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 112 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPG 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 88 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPG 66 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 67 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 95 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPG 82 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 111 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPG 70 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 99 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPG 96 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 125 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 92 QFALYESYYNSLAVVLQRRDWENPG 116 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 117 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 145 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPG 156 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 157 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 185 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 49 QFALYESYYNSLAVVLQRRDWENPG 73 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 74 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 102 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPG 86 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 115 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPG 69 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 70 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 98 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPG 82 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 111 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPG 50 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 79 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 90 QFALYESYYNSLAVVLQRRDWENPG 114 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 115 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 143 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 100 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPG 58 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 87 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPG 67 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 96 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPG 68 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 69 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 97 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 57 QFALYESYYNSLAVVLQRRDWENPG 81 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 82 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 110 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPG 124 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 125 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 153 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPG 80 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 81 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 109 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPG 62 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA +EK P Q Sbjct: 63 VTQLNRLAAHPPFASWRNNEKARTDRPSQ 91 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 150 QFALYESYYNSLAVVLQRRDWENPG 174 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 175 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 203 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPG 65 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 66 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 94 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPG 54 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 83 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 98 QFALYESYYNSLAVVLQRRDWENPG 122 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 123 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 151 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 100 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPG 108 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 109 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 137 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPG 56 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 85 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPG 160 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 161 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 189 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPG 68 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 69 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 97 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPG 70 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 99 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPG 69 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 70 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 98 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPG 139 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 140 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 168 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPG 181 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 182 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 210 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPG 96 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 125 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPG 70 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 99 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPG 54 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 83 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPG 102 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 103 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 131 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPG 476 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 477 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 505 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPG 67 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 96 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPG 52 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 81 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 91 QFALYESYYNSLAVVLQRRDWENPG 115 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 116 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 144 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPG 80 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 81 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 109 >SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPG 102 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 103 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 131 >SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPG 60 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 61 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 89 >SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPG 83 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 112 >SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPG 85 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 86 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 114 >SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPG 60 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 61 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 89 >SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPG 147 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 148 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 176 >SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPG 193 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 194 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 222 >SB_34190| Best HMM Match : MAM (HMM E-Value=0) Length = 384 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPG 90 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 91 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 119 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPG 66 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 67 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 95 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) Length = 331 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 229 QFALYESYYNSLAVVLQRRDWENPG 253 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 254 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 282 >SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 99 QFALYESYYNSLAVVLQRRDWENPG 123 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 124 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 152 >SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPG 58 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 87 >SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPG 58 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 87 >SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPG 50 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 79 >SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPG 100 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 101 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 129 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 66 QFALYESYYNSLAVVLQRRDWENPG 90 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 91 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 119 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPG 75 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 104 >SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) Length = 163 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPG 85 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 86 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 114 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEQARTDRPSQ 78 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPG 82 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 111 >SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) Length = 204 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 102 QFALYESYYNSLAVVLQRRDWENPG 126 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 127 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 155 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPG 65 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 66 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 94 >SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPG 53 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 54 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 82 >SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 126 QFALYESYYNSLAVVLQRRDWENPG 150 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 151 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 179 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) Length = 163 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 61 QFALYESYYNSLAVVLQRRDWENPG 85 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 86 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 114 >SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) Length = 504 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPG 156 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 157 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 185 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 100 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPG 117 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 118 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 146 >SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) Length = 261 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 159 QFALYESYYNSLAVVLQRRDWENPG 183 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 184 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 212 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPG 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 88 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPG 91 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 92 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 120 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 112 QFALYESYYNSLAVVLQRRDWENPG 136 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 137 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 165 >SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPG 50 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 79 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 249 QFALYESYYNSLAVVLQRRDWENPG 273 Score = 43.2 bits (97), Expect = 2e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 527 SYYNSLAGVLQRRDWENPG 583 SYYNSLA VLQRRDWENPG Sbjct: 364 SYYNSLAVVLQRRDWENPG 382 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 274 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 302 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 383 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 411 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 80 QFALYESYYNSLAVVLQRRDWENPG 104 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 105 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 133 >SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPG 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 88 >SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 37 QFALYESYYNSLAVVLQRRDWENPG 61 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 62 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 90 >SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 117 QFALYESYYNSLAVVLQRRDWENPG 141 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 142 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 170 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPG 87 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 88 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 116 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPG 62 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 91 >SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPG 56 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 85 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 63 QFALYESYYNSLAVVLQRRDWENPG 87 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 88 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 116 >SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 85 QFALYESYYNSLAVVLQRRDWENPG 109 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 110 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 138 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPG 108 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 109 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 137 >SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 40 QFALYESYYNSLAVVLQRRDWENPG 64 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 65 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 93 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPG 56 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 85 >SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPG 86 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 115 >SB_16189| Best HMM Match : rve (HMM E-Value=0.3) Length = 595 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 493 QFALYESYYNSLAVVLQRRDWENPG 517 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 518 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 546 >SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 100 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 118 QFALYESYYNSLAVVLQRRDWENPG 142 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 143 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 171 >SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPG 67 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 96 >SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 77 QFALYESYYNSLAVVLQRRDWENPG 101 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 102 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 130 >SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 100 >SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPG 62 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 91 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPG 66 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 67 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 95 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 75 QFALYESYYNSLAVVLQRRDWENPG 99 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 100 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 128 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 93 QFALYESYYNSLAVVLQRRDWENPG 117 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 118 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 146 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 76 QFALYESYYNSLAVVLQRRDWENPG 100 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 101 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 129 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPG 82 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 111 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 123 QFALYESYYNSLAVVLQRRDWENPG 147 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 148 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 176 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPG 79 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 80 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 108 >SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPG 57 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 58 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 86 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPG 54 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 83 >SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) Length = 271 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 169 QFALYESYYNSLAVVLQRRDWENPG 193 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 194 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 222 >SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 97 QFALYESYYNSLAVVLQRRDWENPG 121 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 122 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 150 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 250 QFALYESYYNSLAVVLQRRDWENPG 274 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 275 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 303 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPG 50 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 79 >SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPG 65 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 66 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 94 >SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 53 QFALYESYYNSLAVVLQRRDWENPG 77 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 78 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 106 >SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPG 51 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 80 >SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPG 70 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 99 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 111 QFALYESYYNSLAVVLQRRDWENPG 135 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 136 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 164 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPG 67 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 96 >SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPG 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 88 >SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPG 79 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 80 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 108 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPG 82 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 111 >SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPG 58 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 87 >SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 89 QFALYESYYNSLAVVLQRRDWENPG 113 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 114 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 142 >SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPG 79 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 80 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 108 >SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 81 QFALYESYYNSLAVVLQRRDWENPG 105 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 106 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 134 >SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) Length = 188 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPG 72 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 73 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 101 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 38 QFALYESYYNSLAVVLQRRDWENPG 62 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 91 >SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPG 56 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 85 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPG 83 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 112 >SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 29 QFALYESYYNSLAVVLQRRDWENPG 53 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 54 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 82 >SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 379 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 48 QFALYESYYNSLAVVLQRRDWENPG 72 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 73 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 101 >SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 67 QFALYESYYNSLAVVLQRRDWENPG 91 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 92 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 120 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 33 QFALYESYYNSLAVVLQRRDWENPG 57 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 58 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 86 >SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 121 QFALYESYYNSLAVVLQRRDWENPG 145 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 146 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 174 >SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPG 63 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 92 >SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 36 QFALYESYYNSLAVVLQRRDWENPG 60 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 61 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 89 >SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPG 48 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 49 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 77 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPG 69 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 70 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 98 >SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPG 66 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 67 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 95 >SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPG 83 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 112 >SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 96 QFALYESYYNSLAVVLQRRDWENPG 120 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 121 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 149 >SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPG 52 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 81 >SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPG 48 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 49 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 77 >SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPG 49 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 78 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPG 75 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 104 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPG 71 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SEK P Q Sbjct: 72 VTQLNRLAAHPPFASWRNSEKARTDRPSQ 100 >SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPG 96 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 125 >SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPG 54 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 83 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPG 47 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 76 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPG 58 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 87 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 86 QFALYESYYNSLAVVLQRRDWENPG 110 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 111 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 139 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 65 QFALYESYYNSLAVVLQRRDWENPG 89 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 90 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 118 >SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 277 QFALYESYYNSLAVVLQRRDWENPG 301 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 302 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 330 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPG 67 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 96 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 55 QFALYESYYNSLAVVLQRRDWENPG 79 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 80 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 108 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPG 96 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 125 >SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPG 55 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 84 >SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 68 QFALYESYYNSLAVVLQRRDWENPG 92 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 93 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 121 >SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPG 59 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 88 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPG 78 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 107 >SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = +2 Query: 509 QFAL*GSYYNSLAGVLQRRDWENPG 583 QFAL SYYNSLA VLQRRDWENPG Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPG 83 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 585 VTQLNCLAAHSPFARLAYSEKGPDRSPFQ 671 VTQLN LAAH PFA SE+ P Q Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQ 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,843,726 Number of Sequences: 59808 Number of extensions: 322284 Number of successful extensions: 10063 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9989 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -