BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0080 (619 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 25 0.67 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.67 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.67 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 3.6 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 24.6 bits (51), Expect = 0.67 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 411 RCQWRPSSGYTCAPRPLRETSLPAQRQRRVQ 503 RC RP+SG+ L E L +++ RV+ Sbjct: 64 RCYLRPASGFQSLQFRLLENKLGVRQENRVK 94 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.67 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 411 RCQWRPSSGYTCAPRPLRETSLPAQRQRRVQ 503 RC RP+SG+ L E L +++ RV+ Sbjct: 124 RCYLRPASGFQSLQFRLLENKLGVRQENRVK 154 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 24.6 bits (51), Expect = 0.67 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 411 RCQWRPSSGYTCAPRPLRETSLPAQRQRRVQ 503 RC RP+SG+ L E L +++ RV+ Sbjct: 124 RCYLRPASGFQSLQFRLLENKLGVRQENRVK 154 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 37 SASSVRCVANVSMNCQP 87 S +S+ CV+ SMNC P Sbjct: 28 SMNSMSCVSMPSMNCSP 44 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 3.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -2 Query: 117 ARSTRISYNVRLAVHRDVCDTPYRTCACDVSAPTSNEPP 1 A+ +S NV+ A H + TP A + ++ PP Sbjct: 15 AQIPAMSMNVKAAEHPSLRGTPLAMLAAQCNKLSNKSPP 53 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -1 Query: 424 LHWHLGARDGYC*W 383 L WH G R C W Sbjct: 336 LRWHTGERPFVCNW 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,155 Number of Sequences: 336 Number of extensions: 3198 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -