BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0080 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42132| Best HMM Match : DAGK_cat (HMM E-Value=1.3e-35) 37 0.015 SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) 36 0.026 SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) 33 0.19 SB_15490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 32 0.32 SB_2440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) 29 3.0 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) 29 4.0 SB_58672| Best HMM Match : PHD (HMM E-Value=3e-18) 29 4.0 SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_32010| Best HMM Match : Ada_Zn_binding (HMM E-Value=5.2) 28 5.3 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 28 5.3 SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) 28 5.3 SB_1597| Best HMM Match : PHD (HMM E-Value=1.4e-05) 28 5.3 SB_58132| Best HMM Match : DGPF (HMM E-Value=8.7) 28 7.0 SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) 28 7.0 SB_52774| Best HMM Match : rve (HMM E-Value=2e-17) 28 7.0 SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_40452| Best HMM Match : Upf2 (HMM E-Value=4.3) 28 7.0 SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 7.0 SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 28 7.0 SB_22261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 7.0 SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 28 7.0 SB_46069| Best HMM Match : NOPS (HMM E-Value=2) 28 7.0 SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) 28 7.0 SB_38537| Best HMM Match : VWA (HMM E-Value=0) 28 7.0 SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 7.0 SB_22926| Best HMM Match : DGPF (HMM E-Value=8) 28 7.0 SB_21805| Best HMM Match : Upf2 (HMM E-Value=4) 28 7.0 SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) 28 7.0 SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 28 7.0 SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 7.0 SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_619| Best HMM Match : rve (HMM E-Value=0.027) 28 7.0 SB_49290| Best HMM Match : SAM_1 (HMM E-Value=2) 27 9.2 SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) 27 9.2 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 27 9.2 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 27 9.2 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_33601| Best HMM Match : Metallophos (HMM E-Value=6.4e-19) 27 9.2 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_22850| Best HMM Match : CXC (HMM E-Value=0.22) 27 9.2 SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) 27 9.2 SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_552| Best HMM Match : Laminin_EGF (HMM E-Value=1.3e-23) 27 9.2 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 58.0 bits (134), Expect = 6e-09 Identities = 33/108 (30%), Positives = 46/108 (42%), Gaps = 1/108 (0%) Frame = +2 Query: 83 SLTLYDMRVLRACGVRGLRSCGLQGERDVLRGQRASTRAPLAR-GQPAGQLQVCRVPPPC 259 S T+ D V AC + C G+RA + R G + + C Sbjct: 715 STTVCDYYVHEACQDFSVTDCKQSATYVPFLGKRAVKQDHHWREGNFSASSKCVSCKHSC 774 Query: 260 CSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQPIFLPPSAVSIP 403 S ECL +C WC + H C L+ +EC++G L + LPP VS P Sbjct: 775 GSGECLASLKCSWCAQSSHTNCSQLLPKECHYGYLHRVSLPPFCVSFP 822 >SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1786 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +2 Query: 218 PAGQLQVCRVPPPCCSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQPIFLPP 385 P + VC PC S L +RC WC T H C+ ++ +C G LPP Sbjct: 782 PGARCTVCE--RPCGSKRRLLDFRCLWCNMTVHHSCKLSVVSKCTLGENSLSVLPP 835 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 9/55 (16%) Frame = +3 Query: 102 CEYYVHAECVDFAAADCK--------ENATYCAGSEPRHV-HHWREGNLPANSKC 239 C + H C A +CK ++ C S+P + H W EGNL ++C Sbjct: 732 CRFKSHKRCAAKAPNNCKWTTMQAIRKDNEDCDNSDPMSMPHQWLEGNLTPGARC 786 >SB_42132| Best HMM Match : DAGK_cat (HMM E-Value=1.3e-35) Length = 558 Score = 36.7 bits (81), Expect = 0.015 Identities = 23/75 (30%), Positives = 30/75 (40%), Gaps = 4/75 (5%) Frame = +2 Query: 188 STRAPLARGQPAGQLQVCRVPPPC---CSTEC-LTGYRCEWCGTTCHAGCRALILEECNF 355 S R+ L G L +C C C T L RC WC H C C+F Sbjct: 196 SRRSSLKHHYIRGNLPLCSYCSVCGCLCGTAPRLCDQRCIWCQEKVHDDCLRNQSMICDF 255 Query: 356 GMLQPIFLPPSAVSI 400 G + + LPP +S+ Sbjct: 256 GRYRTLILPPHCISL 270 Score = 36.3 bits (80), Expect = 0.020 Identities = 23/70 (32%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = +3 Query: 36 KRKFCTVCRKRLDELPALHCMICEYYVHAECVDFA--AADCKENATYCAGSEPRHVHHWR 209 K +C C L + LHC C VH EC++ A CK HH+ Sbjct: 152 KPSYCNACENAL--VRGLHCENCTLSVHDECLETANEVFTCK---ALVLSRRSSLKHHYI 206 Query: 210 EGNLPANSKC 239 GNLP S C Sbjct: 207 RGNLPLCSYC 216 >SB_31002| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 1250 Score = 35.9 bits (79), Expect = 0.026 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +2 Query: 203 LARGQPAGQLQVCRVPPPC--CSTEC-LTGYRCEWCGTTCHAGCRALILEECNF 355 ++ G Q + R P C C + G CE CG TCH C A + +C++ Sbjct: 170 MSSGALTHQFKKLRAPSRCRDCDSYVYFNGAECEQCGLTCHKRCLARLTNKCSY 223 >SB_14778| Best HMM Match : MH1 (HMM E-Value=2.8026e-45) Length = 1133 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 33 HKRKFCTVCRKRLDELPALHCMICEYYVHAECVDFAAAD 149 HK C +CR+R + ++ C C ++HA C D AD Sbjct: 437 HKSSACPLCRQRNGQPQSVQCDSCSRWIHAAC-DGITAD 474 >SB_15490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 33.1 bits (72), Expect = 0.19 Identities = 28/103 (27%), Positives = 43/103 (41%) Frame = +2 Query: 212 GQPAGQLQVCRVPPPCCSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQPIFLPPSA 391 G G+L + PP T L +R C AG R+ + L I PP Sbjct: 149 GSALGRLTTKKKTPPR-RTNLLEAFRAATCTP---AGSRSSSISPGMRSSLGSI-APPPR 203 Query: 392 VSIPRTEVPMEAIIGVHVRPPPSQRDFAARAASEKSSTRLRRT 520 S PR+ + + G +R P + ++RA+S +S+ R T Sbjct: 204 TSTPRSRSTLRSRAGSRIRTPSTPTTTSSRASSRESARGTRTT 246 >SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1176 Score = 32.3 bits (70), Expect = 0.32 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 2/91 (2%) Frame = +2 Query: 341 EECNFGMLQPIFLPPSAVSIPRTE--VPMEAIIGVHVRPPPSQRDFAARAASEKSSTRLR 514 +EC+ ++P P S E V ++ +G H R PS D ++ K + + R Sbjct: 917 QECDGLQIEPASCEPPTQSSQYNESLVGCKSPVGGHRRLAPSLSDTEIMSSHLKETVKRR 976 Query: 515 RTFGLPKGLHLGRLSTRNIGRTQATPVIEHQ 607 RT L +GR ++R R AT IEHQ Sbjct: 977 RTTPFSSLLSVGRDASR--ARRSATK-IEHQ 1004 >SB_2440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 598 DHGCCLCPANVPGRQAPQVKPLRKPECPSQP 506 D G C+ +PG P +KP++ P C P Sbjct: 41 DTGICVYKGYLPGGGIPNIKPIQSPVCKVGP 71 >SB_53685| Best HMM Match : bZIP_2 (HMM E-Value=0.99) Length = 716 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 63 CDTPYRTCACDVSAPTS 13 C PY TC CD +AP+S Sbjct: 307 CGKPYSTCDCDSAAPSS 323 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/69 (23%), Positives = 24/69 (34%) Frame = +2 Query: 248 PPPCCSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQPIFLPPSAVSIPRTEVPMEA 427 P CC+ EC G C C + C ILE G + P + P++ Sbjct: 1450 PVKCCTGECPAGCLPSNCKPDCPSKCCLTILEPLQEGPNATAYCPSDCFESCKPNCPIKC 1509 Query: 428 IIGVHVRPP 454 ++ P Sbjct: 1510 CPATAIKCP 1518 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +2 Query: 218 PAGQLQVCRVPPPCCSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQPI 373 PA + C+ P C + CL R C TC C+ EC F +L+PI Sbjct: 1230 PAVCKETCK--PECPLSCCLKDAR--GCPATCVEDCKPGCPPECCFAVLKPI 1277 >SB_38936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 63 CDTPYRTCACDVSAPTS 13 C PY TC CD +AP+S Sbjct: 123 CGKPYSTCDCDSAAPSS 139 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 260 CSTECLTGYRCEWCGTTC-HAGC 325 C C+T + WCG TC +GC Sbjct: 259 CQGACVTDCKSRWCGVTCTGSGC 281 >SB_39590| Best HMM Match : PHD (HMM E-Value=2.2e-18) Length = 1284 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 9 HCWSEQTHHKR-KFCTVCRKRLDE----LPALHCMICEYYVHAEC 128 HC+ T +C +C K + +HC C+++VHA C Sbjct: 917 HCYDCGTAWDNGNYCPICEKCYSDNDFDSKMMHCNDCQHWVHASC 961 >SB_58672| Best HMM Match : PHD (HMM E-Value=3e-18) Length = 458 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +3 Query: 9 HCWSEQTHHKR-KFCTVCRKRLDE----LPALHCMICEYYVHAEC 128 HC+ T +C +C K + +HC C+++VHA C Sbjct: 258 HCYDCGTAWDNGNYCPICEKCYSDNDFDSKMMHCNDCQHWVHASC 302 >SB_33144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 493 EEFNSAAKDIRASEGASLGAPVDQEHWPDTSNTR 594 E+F + +K I SE + PV+Q+ P +NTR Sbjct: 69 EDFENKSKLIANSEQIQINLPVNQQGEPHNNNTR 102 >SB_32010| Best HMM Match : Ada_Zn_binding (HMM E-Value=5.2) Length = 607 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 125 VRGLRSCGLQGERDVLRGQRASTRAPLARGQPAG 226 VRGL + G+Q R V G RA+T A A Q G Sbjct: 59 VRGLVAQGIQSNRRVALGSRATTMAVQATFQTMG 92 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Frame = +3 Query: 327 GRSSWKNATSACFNQFSCL-----HQQYPSRAP 410 GRS WKNA++A F +F H YP+ +P Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSP 34 >SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2271 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 42 KFCTVCRKRLDELP-ALHCMICEYYVHAECVDFAAADCKENA 164 + C VC K A+ C CE + HA+CV + + K+ A Sbjct: 1454 ELCGVCGKGCRSTQKAIECEECEKWFHAKCVRISNMEFKDYA 1495 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 42 KFCTVCRKRLDELP-ALHCMICEYYVHAECVDFAAADCKENA 164 + C VC K A+ C CE + HA+CV + + K+ A Sbjct: 104 ELCGVCGKGCRSTQKAIECEECEKWFHAKCVRISNMEFKDYA 145 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 28.3 bits (60), Expect = 5.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 565 PGRQAPQVKPLRKPECPSQ 509 P R+ P V+P R P CP++ Sbjct: 54 PSRETPPVQPRRNPTCPAE 72 >SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) Length = 887 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 42 KFCTVCRKRLDELP-ALHCMICEYYVHAECVDFAAADCKENA 164 + C VC K A+ C CE + HA+CV + + K+ A Sbjct: 114 ELCGVCGKGCRSTQKAIECEECEKWFHAKCVRISNMEFKDYA 155 >SB_1597| Best HMM Match : PHD (HMM E-Value=1.4e-05) Length = 763 Score = 28.3 bits (60), Expect = 5.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 42 KFCTVCRKRLDELP-ALHCMICEYYVHAECVDFAAADCKENA 164 + C VC K A+ C CE + HA+CV + + K+ A Sbjct: 689 ELCGVCGKGCRSTQKAIECEECEKWFHAKCVRISNMEFKDYA 730 >SB_58132| Best HMM Match : DGPF (HMM E-Value=8.7) Length = 161 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) Length = 1329 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 940 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 987 >SB_52774| Best HMM Match : rve (HMM E-Value=2e-17) Length = 329 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 388 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 435 >SB_40452| Best HMM Match : Upf2 (HMM E-Value=4.3) Length = 245 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 1183 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 794 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 841 >SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1197 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 808 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 855 >SB_22261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 39 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 86 >SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 356 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 615 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 662 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 892 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 939 >SB_46069| Best HMM Match : NOPS (HMM E-Value=2) Length = 278 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) Length = 414 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 39 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 86 >SB_38537| Best HMM Match : VWA (HMM E-Value=0) Length = 1174 Score = 27.9 bits (59), Expect = 7.0 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = +2 Query: 173 RGQRASTRAPLARGQPAGQLQVCRVPPPCCST--ECLTGYRCEWCGTTCHAGCRALILEE 346 + Q + P R QL C+ P C++ EC G +C G+ C CR + +E Sbjct: 28 QAQTQNLVCPTVRTSALTQLN-CKSPAHNCNSDKECPDGEKCCPLGSQCELLCRKAVKQE 86 Query: 347 -CNFGMLQPIFLPPSAVSIPR 406 C + I L S P+ Sbjct: 87 RCAAAIDLAILLDASEAISPQ 107 >SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 327 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 39 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 86 >SB_22926| Best HMM Match : DGPF (HMM E-Value=8) Length = 203 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 39 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 86 >SB_21805| Best HMM Match : Upf2 (HMM E-Value=4) Length = 227 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) Length = 430 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 161 >SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 1234 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 563 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 610 >SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 428 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 39 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 86 >SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 527 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLARDYVFWPSMTAHIKDR 574 >SB_619| Best HMM Match : rve (HMM E-Value=0.027) Length = 290 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 460 SERLRCPRSVREEFNSAAKDIRASEGASLGAPVDQEHWPD-TSNTRDR 600 S+R+ PRS+R E E SL D WP T++ +DR Sbjct: 114 SDRIVVPRSMRAEVLEDIHGAHMGESKSLSLERDYVFWPSMTAHIKDR 161 >SB_49290| Best HMM Match : SAM_1 (HMM E-Value=2) Length = 151 Score = 27.5 bits (58), Expect = 9.2 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 92 LYDMRVLRACGVRGLRSCGLQ-GERDVLRGQRASTRAPLARGQPAGQLQVCRVPPPCCST 268 L D+ VLR C L CGL+ GE ++ + P + G+ L PP C + Sbjct: 27 LDDIAVLRRCSEDDLLKCGLKMGEVKKIKWKLEEIVVPASEGELMVSLP---KEPPSCGS 83 Query: 269 ECLTGYRC 292 + G C Sbjct: 84 FSVPGIVC 91 >SB_43554| Best HMM Match : LIM (HMM E-Value=0.91) Length = 334 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 63 CDTPYRTCACDVSAPTS 13 C PY TC C +AP+S Sbjct: 24 CGNPYSTCGCGSAAPSS 40 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 260 CSTECLTGYRCEWCGTTCHAG 322 C+ +C T + C W GTTC G Sbjct: 1122 CNPKCNT-HECNWDGTTCSLG 1141 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 63 CDTPYRTCACDVSAPTS 13 C PY TC C +AP+S Sbjct: 806 CGNPYSTCGCGSAAPSS 822 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 63 KRLDELPALHCMICEYYVHAEC 128 +++ ++ + C ICE ++HAEC Sbjct: 474 RQISDVAMVKCEICEKWLHAEC 495 >SB_33601| Best HMM Match : Metallophos (HMM E-Value=6.4e-19) Length = 675 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 296 TRSGSQ*GTRWSSRAAARGTLGVGRQVALA 207 T + S G+ WS A G LGVG +ALA Sbjct: 70 TFNASNAGSDWSPSFAVYGDLGVGNPMALA 99 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 239 CRVPPPCCSTECLTGYRCEWCGTTCHAGCRALILEECNFGMLQP 370 CR C T +TGY+C TC G + EE N + P Sbjct: 104 CRNGGMCTGTTSVTGYQC-----TCREGFKGFDCEEINLCVPNP 142 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +3 Query: 48 CTVCRKRLDELPALHCMICEYYVHAECVDFAAADCKENATYC 173 C +C E L + C++ H +CVD + K C Sbjct: 301 CAICLDEYKEGDKLRILPCDHAYHCKCVDPWLTEGKRTCPVC 342 >SB_22850| Best HMM Match : CXC (HMM E-Value=0.22) Length = 418 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 453 RPLRETSLPAQRQRRVQLGCEGH 521 RP+ E + PAQ R ++ C GH Sbjct: 351 RPMSEPAAPAQLLRNIKCNCGGH 373 >SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) Length = 895 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 63 CDTPYRTCACDVSAPTS 13 C+ PY TC C +AP+S Sbjct: 440 CEKPYSTCDCGSAAPSS 456 >SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 272 TRWSSRAAARGTLGVGRQVALAPVVHVS 189 T WS+ ++ RG+ GVGR+V ++ S Sbjct: 1014 TPWSAWSSCRGSCGVGRKVRTRRIIRQS 1041 >SB_552| Best HMM Match : Laminin_EGF (HMM E-Value=1.3e-23) Length = 198 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +2 Query: 278 TGYRCEWCGTTCHAGCRALILEECN 352 +G+ C+WC + H A + CN Sbjct: 107 SGFNCQWCVSGFHGNATAKTCQACN 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,192,237 Number of Sequences: 59808 Number of extensions: 510302 Number of successful extensions: 2147 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 1894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2140 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -