BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0079 (456 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0134 - 13021294-13021350,13021478-13021658,13022383-130224... 30 1.0 11_06_0295 + 22033367-22034947,22035030-22035137,22035230-220353... 28 3.1 >08_02_0134 - 13021294-13021350,13021478-13021658,13022383-13022433, 13025134-13025187,13026154-13026248,13026565-13026888 Length = 253 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 186 ILPSYWQVIIKYKLDRSQLAMLKDEFV*MHFGTKRFN 296 IL YW V+ + R L M+K +V FG +R+N Sbjct: 202 ILLFYWVVLFTVTMKRQILHMIKYRYVPFSFGKQRYN 238 >11_06_0295 + 22033367-22034947,22035030-22035137,22035230-22035370, 22035576-22035625,22036100-22036168,22036649-22036781, 22037634-22037747,22037826-22038038,22038387-22038500, 22038768-22038900,22039304-22039416,22040204-22040284, 22040397-22040483 Length = 978 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 33 KKHTILMSLLTTSCQKHKKPLKP 101 KKHT +SLL+ C KH++ + P Sbjct: 410 KKHTDTVSLLSHMCSKHQRAVLP 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,827,661 Number of Sequences: 37544 Number of extensions: 146802 Number of successful extensions: 237 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 895500300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -