BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0078 (685 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P61165 Cluster: UPF0197 protein C11orf10; n=38; Eukaryo... 33 8.6 UniRef50_Q32P84 Cluster: UPF0197 protein C11orf10 homolog; n=2; ... 33 8.6 >UniRef50_P61165 Cluster: UPF0197 protein C11orf10; n=38; Eukaryota|Rep: UPF0197 protein C11orf10 - Homo sapiens (Human) Length = 79 Score = 32.7 bits (71), Expect = 8.6 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 255 TTSEFT--VYKYLLFYIVALIFVMFNVLFCVLW 163 T++++T +YK LL +VA +F+ F VLF +LW Sbjct: 42 TSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74 >UniRef50_Q32P84 Cluster: UPF0197 protein C11orf10 homolog; n=2; Bos taurus|Rep: UPF0197 protein C11orf10 homolog - Bos taurus (Bovine) Length = 79 Score = 32.7 bits (71), Expect = 8.6 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 255 TTSEFT--VYKYLLFYIVALIFVMFNVLFCVLW 163 T++++T +YK LL +VA +F+ F VLF +LW Sbjct: 42 TSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,149,012 Number of Sequences: 1657284 Number of extensions: 11189929 Number of successful extensions: 22023 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22012 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -