BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0078 (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC015968-1|AAH15968.1| 79|Homo sapiens chromosome 11 open read... 33 1.3 BC002750-1|AAH02750.1| 79|Homo sapiens chromosome 11 open read... 33 1.3 AF086763-1|AAF28401.1| 79|Homo sapiens C11orf10 protein. 33 1.3 >BC015968-1|AAH15968.1| 79|Homo sapiens chromosome 11 open reading frame 10 protein. Length = 79 Score = 32.7 bits (71), Expect = 1.3 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 255 TTSEFT--VYKYLLFYIVALIFVMFNVLFCVLW 163 T++++T +YK LL +VA +F+ F VLF +LW Sbjct: 42 TSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74 >BC002750-1|AAH02750.1| 79|Homo sapiens chromosome 11 open reading frame 10 protein. Length = 79 Score = 32.7 bits (71), Expect = 1.3 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 255 TTSEFT--VYKYLLFYIVALIFVMFNVLFCVLW 163 T++++T +YK LL +VA +F+ F VLF +LW Sbjct: 42 TSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74 >AF086763-1|AAF28401.1| 79|Homo sapiens C11orf10 protein. Length = 79 Score = 32.7 bits (71), Expect = 1.3 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%) Frame = -2 Query: 255 TTSEFT--VYKYLLFYIVALIFVMFNVLFCVLW 163 T++++T +YK LL +VA +F+ F VLF +LW Sbjct: 42 TSTKYTRDIYKELLISLVASLFMGFGVLFLLLW 74 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,224,930 Number of Sequences: 237096 Number of extensions: 1543826 Number of successful extensions: 5891 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5891 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -