BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0077 (669 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19535| Best HMM Match : HEAT (HMM E-Value=1.1) 49 4e-06 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.091 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 32 0.49 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 31 0.64 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 31 0.64 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 30 1.5 SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 30 2.0 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 29 2.6 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 29 2.6 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 29 2.6 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 29 2.6 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 29 2.6 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 29 2.6 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 29 2.6 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 29 2.6 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 2.6 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 2.6 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 29 2.6 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 29 2.6 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 29 2.6 SB_9466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 28 6.0 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 28 6.0 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 28 6.0 SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) 28 7.9 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 28 7.9 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_19535| Best HMM Match : HEAT (HMM E-Value=1.1) Length = 368 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/54 (44%), Positives = 32/54 (59%) Frame = -1 Query: 246 GGDYRPXXXXXXXXXXXKHDPYAYLPLSRTNLNKRKKSVNSKQFKGIVKSKTKG 85 G +YR K DPYAYLPL+ + LN+RK+ + QFKGIV++ KG Sbjct: 303 GAEYRAKRAGGDVKKKGKPDPYAYLPLNMSTLNRRKQRKVAGQFKGIVRASKKG 356 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 34.7 bits (76), Expect = 0.069 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 28 LKLVDPPGCRNSAAAD 75 L+LVDPPGCRNS AAD Sbjct: 13 LELVDPPGCRNSIAAD 28 >SB_8051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 840 Score = 34.3 bits (75), Expect = 0.091 Identities = 29/108 (26%), Positives = 40/108 (37%), Gaps = 1/108 (0%) Frame = -2 Query: 578 RSGVRTAGSGLAPDGPTHHQRPGLXXXXDEPKPSGXXXXXXXXXDNETQGGKPS-KLLKP 402 R T G+ P GP+H+ R +PKPSG KPS P Sbjct: 319 RDQATTLGTKPQPSGPSHNPRDHATTLGIKPKPSGPSQNPRDQAKTLGTKPKPSGPSQNP 378 Query: 401 GTKRRYDDILSIRSGRSNRSRASTATVGSKYKTGGKGIHRNLDSAASV 258 G + SG S+ R T+G+K + G H D A ++ Sbjct: 379 GDQATTLGTKPQPSGPSHNPRDQATTLGTKPQPWGPS-HNPRDQATTL 425 Score = 29.5 bits (63), Expect = 2.6 Identities = 26/93 (27%), Positives = 34/93 (36%), Gaps = 3/93 (3%) Frame = -2 Query: 566 RTAGSGLAPDGPTHHQRPGLXXXXDEPKPSGXXXXXXXXXDNETQGGKPSKLLKPGTKRR 387 +T G+ P GP+H+ R +PKP G T G KP R Sbjct: 263 KTLGTKPQPSGPSHNPRDQATTLGTKPKPWGPSQNPGDQA--TTLGTKPQPWGPSQNPRD 320 Query: 386 YDDILSIR---SGRSNRSRASTATVGSKYKTGG 297 L + SG S+ R T+G K K G Sbjct: 321 QATTLGTKPQPSGPSHNPRDHATTLGIKPKPSG 353 Score = 29.1 bits (62), Expect = 3.4 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 3/92 (3%) Frame = -2 Query: 563 TAGSGLAPDGPTHHQRPGLXXXXDEPKPSGXXXXXXXXXDNETQGGKP---SKLLKPGTK 393 T G+ P GP+H+ R +P+PSG +T G KP PG + Sbjct: 610 TLGTKPQPSGPSHNPRDQATTLGTKPQPSGPSHNPRDQA--KTLGTKPQPWGPSHNPGDQ 667 Query: 392 RRYDDILSIRSGRSNRSRASTATVGSKYKTGG 297 SG S++ T+G+K ++ G Sbjct: 668 ATTLGTKPKPSGPSHKPGDQATTLGTKAQSSG 699 Score = 28.7 bits (61), Expect = 4.5 Identities = 26/111 (23%), Positives = 40/111 (36%), Gaps = 1/111 (0%) Frame = -2 Query: 578 RSGVRTAGSGLAPDGPTHHQRPGLXXXXDEPKPSGXXXXXXXXXDNETQGGKPS-KLLKP 402 R T G+ P GP+H+ R +P+P G KPS KP Sbjct: 625 RDQATTLGTKPQPSGPSHNPRDQAKTLGTKPQPWGPSHNPGDQATTLGTKPKPSGPSHKP 684 Query: 401 GTKRRYDDILSIRSGRSNRSRASTATVGSKYKTGGKGIHRNLDSAASVALR 249 G + + SG S+ T+ +K + G H D A ++ + Sbjct: 685 GDQATTLGTKAQSSGPSHNPGGQATTLETKQQPWGPS-HNPRDQATTLGTK 734 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSNS 87 L+LVDPPGCRNS A+ S S Sbjct: 13 LELVDPPGCRNSMNANVSYS 32 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSNSFCF*FHY 108 L+LVDPPGCRNS A + F + Y Sbjct: 13 LELVDPPGCRNSIQARSVDGFAKGYGY 39 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADP 78 L+LVDPPGCRNS P Sbjct: 100 LELVDPPGCRNSITGGP 116 >SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) Length = 247 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -2 Query: 80 EGSAAAEFLQPGGSTSFR 27 +GSA EFLQPGGSTS R Sbjct: 119 KGSALIEFLQPGGSTSSR 136 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.85 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 28 LKLVDPPGCRNSAAAD 75 L+LVDPPGCRNS D Sbjct: 13 LELVDPPGCRNSITKD 28 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 0.85 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPS 81 L+LVDPPGCRNS DPS Sbjct: 13 LELVDPPGCRNS-ILDPS 29 >SB_17731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 0.85 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -2 Query: 89 KEFEGSAAAEFLQPGGSTSFR 27 KE EG EFLQPGGSTS R Sbjct: 9 KEPEGPKHIEFLQPGGSTSSR 29 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 28 LKLVDPPGCRNSAA 69 L+LVDPPGCRNS A Sbjct: 13 LELVDPPGCRNSIA 26 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 Query: 28 LKLVDPPGCRNSAAA 72 L+LVDPPGCRNS A Sbjct: 13 LELVDPPGCRNSMVA 27 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 28 LKLVDPPGCRNSAA 69 L+LVDPPGCRNS A Sbjct: 89 LELVDPPGCRNSIA 102 >SB_9748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 92 QKEFEGSAAAEFLQPGGSTSFR 27 +K F A+ EFLQPGGSTS R Sbjct: 26 EKPFRIHASIEFLQPGGSTSSR 47 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSNSFCF 96 L+LVDPPGCRNS + F + Sbjct: 13 LELVDPPGCRNSMLPKRTEGFAW 35 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSNS 87 L+LVDPPGCRNS P ++ Sbjct: 33 LELVDPPGCRNSMPDRPRHA 52 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 4/25 (16%) Frame = +1 Query: 28 LKLVDPPGCRNS----AAADPSNSF 90 L+LVDPPGCRNS AA D + +F Sbjct: 13 LELVDPPGCRNSIHEAAALDGAGTF 37 >SB_39991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 101 NQKQKEFEGSAAAEFLQPGGSTSFR 27 N+ +K S EFLQPGGSTS R Sbjct: 28 NKCEKHLPPSVIIEFLQPGGSTSSR 52 >SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G+ A EFLQPGGSTS R Sbjct: 5 GAGAIEFLQPGGSTSSR 21 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 28 LKLVDPPGCRNSAAA 72 L+LVDPPGCRNS ++ Sbjct: 657 LELVDPPGCRNSISS 671 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSN 84 L+LVDPPGCRNS DP++ Sbjct: 13 LELVDPPGCRNS--MDPND 29 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 28 LKLVDPPGCRNSAAADPSN 84 L+LVDPPGCRNS + N Sbjct: 50 LELVDPPGCRNSINIESVN 68 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 29.5 bits (63), Expect = 2.6 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = -2 Query: 182 TPTY-PCPGQISIKGKNLS--TANSSKG**NQKQKEFEGSAAAEFLQPGGSTSFR 27 +PTY P + +IK +NL+ T N +G + + + EFLQPGGSTS R Sbjct: 18 SPTYKPRINKTTIKSRNLNKFTLNVRQG---RDVFQSIRDKSIEFLQPGGSTSSR 69 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 89 LELVDPPGCRNS 100 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 80 EGSAAAEFLQPGGSTSFR 27 EG EFLQPGGSTS R Sbjct: 50 EGQKLIEFLQPGGSTSSR 67 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 30 LELVDPPGCRNS 41 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 70 LELVDPPGCRNS 81 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 68 LELVDPPGCRNS 79 >SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 89 KEFEGSAAAEFLQPGGSTSFR 27 K FE EFLQPGGSTS R Sbjct: 19 KSFETLEFIEFLQPGGSTSSR 39 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 30 LELVDPPGCRNS 41 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_23429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 83 FEGSAAAEFLQPGGSTSFR 27 FE EFLQPGGSTS R Sbjct: 21 FENEIRIEFLQPGGSTSSR 39 >SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 89 KEFEGSAAAEFLQPGGSTSFR 27 KE ++ EFLQPGGSTS R Sbjct: 190 KEVRWTSGIEFLQPGGSTSSR 210 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 100 LELVDPPGCRNS 111 >SB_9466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 559 RVPDLPQTGRLIISDQASMMTTTNRSPAATLTRTPMTQTTKPKAAS 422 ++P L Q L S + + TTT + T T T T TT AA+ Sbjct: 45 KIPSLSQNSNLGHSGENEITTTTTTTITTTTTTTTTTTTTTTTAAA 90 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 76 LELVDPPGCRNS 87 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 28 LKLVDPPGCRNS 63 L+LVDPPGCRNS Sbjct: 13 LELVDPPGCRNS 24 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 71 AAAEFLQPGGSTSFR 27 AA EFLQPGGSTS R Sbjct: 2 AAIEFLQPGGSTSSR 16 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 Query: 83 FEGSAAAEFLQPGGSTSFR 27 F G + EFLQPGGSTS R Sbjct: 45 FGGFSRIEFLQPGGSTSSR 63 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 74 SAAAEFLQPGGSTSFR 27 S A EFLQPGGSTS R Sbjct: 7 SVAIEFLQPGGSTSSR 22 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 GS EFLQPGGSTS R Sbjct: 38 GSQPIEFLQPGGSTSSR 54 >SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 98 QKQKEFEGSAAAEFLQPGGSTSFR 27 +K+ F+ EFLQPGGSTS R Sbjct: 34 KKRLRFQMKTDIEFLQPGGSTSSR 57 >SB_4076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 GS EFLQPGGSTS R Sbjct: 7 GSLLIEFLQPGGSTSSR 23 >SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 92 QKEFEGSAAAEFLQPGGSTSFR 27 +KE EFLQPGGSTS R Sbjct: 2 EKEGHAGKMIEFLQPGGSTSSR 23 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -2 Query: 101 NQKQKEFEGSAA-AEFLQPGGSTSFR 27 + KQK FE EFLQPGGSTS R Sbjct: 18 HSKQKWFEFLIGDIEFLQPGGSTSSR 43 >SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 83 FEGSAAAEFLQPGGSTSFR 27 FE EFLQPGGSTS R Sbjct: 18 FENLEPIEFLQPGGSTSSR 36 >SB_38570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G + EFLQPGGSTS R Sbjct: 7 GKSGLEFLQPGGSTSSR 23 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 74 SAAAEFLQPGGSTSFR 27 SA EFLQPGGSTS R Sbjct: 27 SAKIEFLQPGGSTSSR 42 >SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 80 EGSAAAEFLQPGGSTSFR 27 +G EFLQPGGSTS R Sbjct: 5 KGEKTIEFLQPGGSTSSR 22 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -2 Query: 143 GKNLSTANSSKG**NQKQKEFEGSAAAEFLQPGGSTSFR 27 GK S G + ++ A EFLQPGGSTS R Sbjct: 20 GKTYGVYMSDNGRSQRSKQAAVRRAQIEFLQPGGSTSSR 58 >SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 Query: 95 KQKEFEGSAAAEFLQPGGSTSFR 27 ++K G EFLQPGGSTS R Sbjct: 23 RKKREHGPYYIEFLQPGGSTSSR 45 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G + EFLQPGGSTS R Sbjct: 7 GESRIEFLQPGGSTSSR 23 >SB_41674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = -2 Query: 74 SAAAEFLQPGGSTSFR 27 S A EFLQPGGSTS R Sbjct: 18 SFAIEFLQPGGSTSSR 33 >SB_28613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 89 KEFEGSAAAEFLQPGGSTSFR 27 K + + EFLQPGGSTS R Sbjct: 8 KAHDNESGIEFLQPGGSTSSR 28 >SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) Length = 436 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 95 KQKEFEGSAAAEFLQPGGSTSFR 27 K++ E + EFLQPGGSTS R Sbjct: 303 KERIPEDQLSIEFLQPGGSTSSR 325 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 98 QKQKEFEGSAAAEFLQPGGSTSFR 27 +K + + EFLQPGGSTS R Sbjct: 57 RKNRRTSAGISIEFLQPGGSTSSR 80 >SB_636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G+ EFLQPGGSTS R Sbjct: 6 GTLTIEFLQPGGSTSSR 22 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 95 KQKEFEGSAAAEFLQPGGSTSFR 27 ++ F EFLQPGGSTS R Sbjct: 10 RKHRFSSDHRIEFLQPGGSTSSR 32 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 95 KQKEFEGSAAAEFLQPGGSTSFR 27 KQ EFLQPGGSTS R Sbjct: 8 KQSVISEGCPIEFLQPGGSTSSR 30 >SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 80 EGSAAAEFLQPGGSTSFR 27 +G + EFLQPGGSTS R Sbjct: 1 DGLSFIEFLQPGGSTSSR 18 >SB_14431| Best HMM Match : HTH_5 (HMM E-Value=7.8e-06) Length = 177 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 86 EFEGSAAAEFLQPGGSTSFR 27 EFE A EFLQPGGSTS R Sbjct: 148 EFE---AIEFLQPGGSTSSR 164 >SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 80 EGSAAAEFLQPGGSTSFR 27 +G+ EFLQPGGSTS R Sbjct: 16 KGTYLIEFLQPGGSTSSR 33 >SB_5839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 235 QTEESQGRYQEEGQARSLRLPTPVQDKSQ*KEKICQQQTVQRDSE 101 Q ++ Q + Q++ Q + + P P Q + Q +E+ QQQ Q+ + Sbjct: 22 QQQQQQQQQQQQQQQQQQQQPQPQQQQQQQQEQEQQQQQQQQQQQ 66 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 89 KEFEGSAAAEFLQPGGSTSFR 27 K + + EFLQPGGSTS R Sbjct: 4 KRWHQNTVIEFLQPGGSTSSR 24 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 98 QKQKEFEGSAAAEFLQPGGSTSFR 27 + +E + + EFLQPGGSTS R Sbjct: 19 EADQEIQYNPEIEFLQPGGSTSSR 42 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G EFLQPGGSTS R Sbjct: 2 GQVIIEFLQPGGSTSSR 18 >SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 74 SAAAEFLQPGGSTSFR 27 +A EFLQPGGSTS R Sbjct: 10 TACIEFLQPGGSTSSR 25 >SB_46022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G EFLQPGGSTS R Sbjct: 11 GEKGIEFLQPGGSTSSR 27 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 31 KLVDPPGCRNS 63 +LVDPPGCRNS Sbjct: 319 ELVDPPGCRNS 329 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G + EFLQPGGSTS R Sbjct: 18 GRSKIEFLQPGGSTSSR 34 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 77 GSAAAEFLQPGGSTSFR 27 G+ EFLQPGGSTS R Sbjct: 22 GTRLIEFLQPGGSTSSR 38 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,457,068 Number of Sequences: 59808 Number of extensions: 248848 Number of successful extensions: 1440 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 1349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -