BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0076 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29511| Best HMM Match : CHGN (HMM E-Value=0.00037) 28 4.2 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 28 5.6 SB_59035| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_29511| Best HMM Match : CHGN (HMM E-Value=0.00037) Length = 955 Score = 28.3 bits (60), Expect = 4.2 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 173 HFRELFLTPSEL*TLRLINNSKNMPTCMRDIDPDLIMLIINKW 301 H + P+ + TL+ S PT DPD+ I+KW Sbjct: 100 HDESTHMAPTAISTLQTTTTSTTTPTTPHSRDPDISHTKISKW 142 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 413 FPYQKENKTSFEMNKLQMSKRMLRLRDRLR 324 F ++ + K +FE +L++ KR L+D+L+ Sbjct: 89 FTFEDKRKQNFEKGRLELEKRRQDLQDKLK 118 >SB_59035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.1 bits (57), Expect = 9.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 461 CALQHSFEILLLEIDFFPYQKENKTSFEMNKLQMSKRM 348 C+ S E+L+L + ++ ++KTSF + Q RM Sbjct: 62 CSGDRSKEVLVLRLSMSKWEYDSKTSFHCDNAQGHHRM 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,733,568 Number of Sequences: 59808 Number of extensions: 269824 Number of successful extensions: 530 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -