BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0076 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061504-1|AAL29052.1| 263|Drosophila melanogaster LD46221p pro... 29 5.3 AE013599-2643|AAF57732.2| 263|Drosophila melanogaster CG10916-P... 29 5.3 U89162-1|AAC62307.1| 435|Drosophila melanogaster Int6 protein. 28 9.3 AY122062-1|AAM52574.1| 372|Drosophila melanogaster AT01736p pro... 28 9.3 AF132551-1|AAD27850.1| 435|Drosophila melanogaster GM01233p pro... 28 9.3 AE014297-3049|AAN13885.1| 381|Drosophila melanogaster CG31335-P... 28 9.3 AE014296-2801|AAF49412.1| 435|Drosophila melanogaster CG9677-PA... 28 9.3 >AY061504-1|AAL29052.1| 263|Drosophila melanogaster LD46221p protein. Length = 263 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 319 PTRNLSRSLNIRLDICN-LFISNEVLFS 399 PT + S SLNI ICN F +N+++FS Sbjct: 20 PTNDSSPSLNILCAICNEFFRANDIIFS 47 >AE013599-2643|AAF57732.2| 263|Drosophila melanogaster CG10916-PA protein. Length = 263 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 319 PTRNLSRSLNIRLDICN-LFISNEVLFS 399 PT + S SLNI ICN F +N+++FS Sbjct: 20 PTNDSSPSLNILCAICNEFFRANDIIFS 47 >U89162-1|AAC62307.1| 435|Drosophila melanogaster Int6 protein. Length = 435 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 375 HFE*SFIFFLIGKEIYFQQQNLKRMLQGTITGPDFLSHTFNCTANFRL 518 H + FL GKEIY QQ+ L+ +L+ T+ + + +T + L Sbjct: 17 HLTFPLLEFLCGKEIYNQQELLEYILE-TVNKTNMIDYTMDTRKRLNL 63 >AY122062-1|AAM52574.1| 372|Drosophila melanogaster AT01736p protein. Length = 372 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 375 HFE*SFIFFLIGKEIYFQQQNLKRMLQGTITGPDFLSHTFNCTANFRL 518 H + FL GKEIY QQ+ L+ +L+ T+ + + +T + L Sbjct: 17 HLTFPLLEFLCGKEIYNQQELLEYILE-TVNKTNMIDYTMDTRKRLNL 63 >AF132551-1|AAD27850.1| 435|Drosophila melanogaster GM01233p protein. Length = 435 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 375 HFE*SFIFFLIGKEIYFQQQNLKRMLQGTITGPDFLSHTFNCTANFRL 518 H + FL GKEIY QQ+ L+ +L+ T+ + + +T + L Sbjct: 17 HLTFPLLEFLCGKEIYNQQELLEYILE-TVNKTNMIDYTMDTRKRLNL 63 >AE014297-3049|AAN13885.1| 381|Drosophila melanogaster CG31335-PA protein. Length = 381 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 314 GFQHVIYPVASTYAWTFVTCSFRMKFYFLF 403 GFQH+I+ V+ TY F+ C+ M F F++ Sbjct: 164 GFQHIIWWVSYTY--VFIICNSIMCFGFIW 191 >AE014296-2801|AAF49412.1| 435|Drosophila melanogaster CG9677-PA protein. Length = 435 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 375 HFE*SFIFFLIGKEIYFQQQNLKRMLQGTITGPDFLSHTFNCTANFRL 518 H + FL GKEIY QQ+ L+ +L+ T+ + + +T + L Sbjct: 17 HLTFPLLEFLCGKEIYNQQELLEYILE-TVNKTNMIDYTMDTRKRLNL 63 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,340,292 Number of Sequences: 53049 Number of extensions: 400696 Number of successful extensions: 683 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -