BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0076 (538 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical ... 29 1.6 Z95621-1|CAB09130.1| 357|Caenorhabditis elegans Hypothetical pr... 29 2.1 >AL032646-5|CAA21682.1| 1798|Caenorhabditis elegans Hypothetical protein Y54E2A.6 protein. Length = 1798 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = -3 Query: 494 ECV*KKVWTSYCALQHSFEILLLEIDFFPYQKENKTSFEMNKLQMSKRML 345 +CV K++W + CAL+ +I+ + I + + E K + E + L++S + L Sbjct: 745 KCVEKQMWMNQCALRQFIQIINIPITWIE-KIERKKARESDLLELSAKDL 793 >Z95621-1|CAB09130.1| 357|Caenorhabditis elegans Hypothetical protein VC27A7L.1 protein. Length = 357 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 45 PLLG*QY-GAP*RLLIKTIMTSITGVTAWTCYLC 143 P+LG Y GA +L++ T + I+ ++ WT Y C Sbjct: 230 PILGSTYWGASTKLIVSTGIVIISIISCWTIYFC 263 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,296,999 Number of Sequences: 27780 Number of extensions: 217788 Number of successful extensions: 464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1070714938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -