BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0073 (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) 34 0.072 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 33 0.13 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 33 0.13 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 33 0.22 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 32 0.29 SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) 32 0.29 SB_15882| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) 31 0.67 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 31 0.67 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 30 1.2 SB_34641| Best HMM Match : Mucin (HMM E-Value=4.3) 30 1.2 SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) 29 2.1 SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) 29 2.1 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 29 2.1 SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) 29 2.7 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 29 2.7 SB_45816| Best HMM Match : Exo_endo_phos (HMM E-Value=0.004) 29 3.6 SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) 29 3.6 SB_23397| Best HMM Match : DSL (HMM E-Value=0.00011) 29 3.6 SB_14554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 29 3.6 SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_24702| Best HMM Match : C1_4 (HMM E-Value=0.98) 29 3.6 SB_22215| Best HMM Match : Rib_hydrolayse (HMM E-Value=0.035) 29 3.6 SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) 28 6.3 SB_43809| Best HMM Match : PSGP (HMM E-Value=0.069) 28 6.3 SB_45248| Best HMM Match : rve (HMM E-Value=2.1e-05) 27 8.3 SB_28193| Best HMM Match : rve (HMM E-Value=2.1e-05) 27 8.3 >SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) Length = 772 Score = 34.3 bits (75), Expect = 0.072 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 283 AVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERGLFCNGEKDC 432 A+ N + + IKP C G C + CI + L+C+G+ C Sbjct: 67 AIANVSITTRSCAIKPTFSFPGHSCGSGEFQCDNGKCIRKNLYCDGDFAC 116 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C+ C D C+ FCNGE DC Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDC 99 Score = 31.5 bits (68), Expect = 0.51 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 373 ACGDSTCIERGLFCNGEKDC 432 AC D TC+ L CNG DC Sbjct: 117 ACADGTCVTWSLTCNGVSDC 136 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 33.5 bits (73), Expect = 0.13 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C+ C D C+ FCNGE DC Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDC 99 Score = 31.5 bits (68), Expect = 0.51 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 373 ACGDSTCIERGLFCNGEKDC 432 AC D TC+ L CNG DC Sbjct: 117 ACADGTCVTWSLTCNGVSDC 136 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 32.7 bits (71), Expect = 0.22 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C DG +C D CI R C+G DC Sbjct: 3207 CADGQFSCDDGLCIARAWKCDGMMDC 3232 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C AC + CI L C+G+ DC Sbjct: 2370 CTGAQFACDNGRCISTRLLCDGDNDC 2395 Score = 28.7 bits (61), Expect = 3.6 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C AC C+ + C+G+ DC Sbjct: 2168 CASSEFACESGQCVRKSFVCDGDNDC 2193 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 349 PLCQDGFLACGDSTCIERGLFCNGEKDC 432 P C G C + CI C+GE DC Sbjct: 823 PPCSAGKFTCKNGHCISLRWKCDGENDC 850 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C+ G +C + CI C+ E DC Sbjct: 2209 CEPGHFSCNNGRCINAKWVCDRENDC 2234 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C C + CI + C+GE DC Sbjct: 47 CPPTKFLCANGMCIPKSAVCDGENDC 72 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 32.7 bits (71), Expect = 0.22 Identities = 19/68 (27%), Positives = 29/68 (42%) Frame = +1 Query: 229 LPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERGL 408 +PGRF + D D +NC+ + E +C DG + C+ R Sbjct: 436 IPGRFRCDHRSDCLDGSDE-QNCQNVTRPTPPPVKCRKNERMCADG------NGCVHRRW 488 Query: 409 FCNGEKDC 432 C+GE+DC Sbjct: 489 ICDGERDC 496 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C C +S C+ C+GE DC Sbjct: 343 CPPSDFTCANSQCVPNSFRCDGENDC 368 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 32.3 bits (70), Expect = 0.29 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C + C + C++RGL C+G+K C Sbjct: 183 CLEDEFGCENGQCVKRGLLCDGDKAC 208 Score = 28.3 bits (60), Expect = 4.8 Identities = 18/76 (23%), Positives = 26/76 (34%) Frame = +1 Query: 205 CLGNTSYTLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGD 384 C + LPG L ++ C+ VK L + ++ + C C Sbjct: 170 CAVQPPFALPGHECLE-DEFGCENGQCVKRGLLCDGDKACLDGSDEKHCSCPSNMFLCPS 228 Query: 385 STCIERGLFCNGEKDC 432 CI CN E DC Sbjct: 229 GECIPTTALCNNENDC 244 >SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) Length = 106 Score = 32.3 bits (70), Expect = 0.29 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C C D TCI+R CNG+ DC Sbjct: 4 CPGSKYECRDGTCIDRNEHCNGKIDC 29 >SB_15882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 933 Score = 31.1 bits (67), Expect = 0.67 Identities = 17/68 (25%), Positives = 27/68 (39%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+EKQ C W+D K+ IKP + + C + + T + Sbjct: 524 TTPSQTAQRFEKQQCIWRDTNNLIKINRVPGNIKP--HKQMVFCHINARSVRNKTTVIND 581 Query: 406 LFCNGEKD 429 C+ D Sbjct: 582 YICDHSVD 589 >SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) Length = 979 Score = 31.1 bits (67), Expect = 0.67 Identities = 17/68 (25%), Positives = 27/68 (39%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+EKQ C W+D K+ IKP + + C + + T + Sbjct: 125 TTPSQTAQRFEKQQCIWRDTNNLIKINRVPGNIKP--HKQMVFCHINARSVRNKTTVIND 182 Query: 406 LFCNGEKD 429 C+ D Sbjct: 183 YICDHSVD 190 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 31.1 bits (67), Expect = 0.67 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 349 PLCQDGFLACGDSTCIERGLFCNGEKDC 432 P+CQ G C +CI+ G C+ DC Sbjct: 2091 PMCQYGQFRCARGSCIDTGRVCDFTDDC 2118 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 349 PLCQDGFLACGDSTCIERGLFCNGEKDC 432 P C G C D +CI + L C+ + DC Sbjct: 2244 PPCPFGLFRCTDGSCIMQSLRCDYQNDC 2271 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 376 CGDSTCIERGLFCNGEKDC 432 C CIE FC+G+KDC Sbjct: 703 CSSGECIEVATFCDGKKDC 721 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/49 (20%), Positives = 23/49 (46%) Frame = +1 Query: 283 AVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERGLFCNGEKD 429 A+++ ++ ++ P++ C D C + C+ + CNG +D Sbjct: 635 AIRDIQITTEDCLCTPVIAEPGYKCLDHLFTCNNGECVTKTSRCNGMRD 683 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +1 Query: 295 CKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERGLFCNGEKDC 432 C+ +N E + T C G CG+ CI C+ + DC Sbjct: 168 CRCQNGEVLVNGQCKTLSGTCAPGQFKCGNGKCIPSSWKCDHDNDC 213 >SB_34641| Best HMM Match : Mucin (HMM E-Value=4.3) Length = 199 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 87 RRQRKMKAWNKNYARTRTPANGSGWW 164 RR K KAW ART P G+ +W Sbjct: 44 RRDTKHKAWTTRSARTWVPVTGTPYW 69 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = -2 Query: 528 SSQERTHARNRMAELYLGRCQYHKEFSSDPSPTVLFAVTEKTAFNASRVAASEEAILTEW 349 ++QE T A+N+MA + CQ +E ++ V V VA ++++ W Sbjct: 1273 TTQETTLAQNKMAVVATCVCQARQELNAHAPGRVCCPVITSRVLKVGYVARVGQSVVVNW 1332 Query: 348 F 346 F Sbjct: 1333 F 1333 >SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) Length = 130 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 352 LCQDGFLACGDST-CIERGLFCNGEKDC 432 +C+D CG S CI + C+G+ DC Sbjct: 42 VCRDDQFQCGTSRKCIRKSKICDGKSDC 69 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 259 KQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGD-STCIERGLFCNGEKDC 432 K C + KNC PL +P C+ C + S C++R C+G +DC Sbjct: 66 KSDCSGGEDEKNCVKPQTPPPTPPL----KPKCRISQRRCDNGSGCVDRMKICDGMRDC 120 >SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) Length = 48 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +1 Query: 352 LCQDGFLACG-----DSTCIERGLFCNGEKDC 432 LC G+ CG + +CI + L CNG DC Sbjct: 6 LCPSGYFYCGTGPKGEISCINKALRCNGIYDC 37 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 331 LLYTEEPLCQDGFLACGDSTCIERGLFCNGEKDC 432 LL+ C G C S CI L C+G +DC Sbjct: 15 LLFRVVGCCDPGQFECTSSECIPDVLKCDGSEDC 48 >SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) Length = 1571 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 349 PLCQDGFLACG-DSTCIERGLFCNGEKDC 432 P C +G CG C+ + L CNG+ DC Sbjct: 724 PGCGNGEFYCGVPGECVPQTLRCNGQMDC 752 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +1 Query: 352 LCQDGFLACG-----DSTCIERGLFCNGEKDC 432 LC G+ CG + +CI + L CNG DC Sbjct: 1529 LCPSGYFYCGTGPKGEISCITKALRCNGIYDC 1560 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 29.1 bits (62), Expect = 2.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 355 CQDGFLACGDSTCIERGLFCNGEKDC 432 C G +C + CI R C+ + DC Sbjct: 50 CNSGQFSCSNGRCISRSWVCDRDNDC 75 >SB_45816| Best HMM Match : Exo_endo_phos (HMM E-Value=0.004) Length = 377 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/68 (23%), Positives = 26/68 (38%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+ KQ C W+D K+ IKP + + C + + T + Sbjct: 22 TTPSQTAQRFAKQQCIWRDTNNLIKINRVPGNIKP--HKQMVFCHINARSVRNKTTVIND 79 Query: 406 LFCNGEKD 429 C+ D Sbjct: 80 YICDHSVD 87 >SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0) Length = 1311 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 214 NTSY---TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKP 330 NTS+ T P + R+ KQ C W+D K+ IKP Sbjct: 64 NTSHIPLTTPSQTAQRFAKQQCIWRDTNNLIKINRVPGDIKP 105 >SB_23397| Best HMM Match : DSL (HMM E-Value=0.00011) Length = 331 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +1 Query: 202 YCLGNTSYTLPGRFVLRYE--KQTC--DWKDAVKNCKLKNKE 315 YC+ S L G +V Y ++ C W DAV NC K KE Sbjct: 253 YCVSRDS-DLEGHYVCDYVQGRKVCREGWYDAVSNCTKKKKE 293 >SB_14554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/68 (23%), Positives = 26/68 (38%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+ KQ C W+D K+ IKP + + C + + T + Sbjct: 129 TTPSQTAQRFAKQQCIWRDTNNLIKINRVPGNIKP--HKQMVFCHINARSVRNKTTVIND 186 Query: 406 LFCNGEKD 429 C+ D Sbjct: 187 YICDHSVD 194 >SB_3501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/68 (23%), Positives = 26/68 (38%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+ KQ C W+D K+ IKP + + C + + T + Sbjct: 71 TTPSQTAQRFAKQQCIWRDTNNLIKINRVPGNIKP--HKQMVFCHINARSVRNKTTVIND 128 Query: 406 LFCNGEKD 429 C+ D Sbjct: 129 YICDHSVD 136 >SB_46881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/68 (23%), Positives = 27/68 (39%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+ KQ C W+D K+ + IKP + + C + + T + Sbjct: 191 TTPSQTAQRFVKQQCIWRDTNNLIKINSVPGNIKP--HKQMVFCHINARSVRNKTTVIND 248 Query: 406 LFCNGEKD 429 C+ D Sbjct: 249 YICDHSVD 256 >SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 919 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/68 (23%), Positives = 26/68 (38%) Frame = +1 Query: 226 TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERG 405 T P + R+ KQ C W+D K+ IKP + + C + + T + Sbjct: 252 TTPSQTAQRFAKQQCIWRDTNNLIKINRAPGDIKP--HKQMVFCHINARSVRNKTTVIND 309 Query: 406 LFCNGEKD 429 C+ D Sbjct: 310 YICDHSVD 317 >SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 861 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 214 NTSY---TLPGRFVLRYEKQTCDWKDAVKNCKLKNKERKIKP 330 NTS+ T P + R+ KQ C W+D K+ IKP Sbjct: 153 NTSHIPLTTPSQTAQRFAKQQCIWRDTNNLIKINRVPGDIKP 194 >SB_24702| Best HMM Match : C1_4 (HMM E-Value=0.98) Length = 221 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/59 (27%), Positives = 23/59 (38%) Frame = +1 Query: 244 VLRYEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEPLCQDGFLACGDSTCIERGLFCNG 420 V + ++ D A KNC+ KNK K ++G C C+ F NG Sbjct: 145 VEHFSEKLADKAKACKNCQSKNKRLKAGNKAVQRAKETRNGCRKCDVHLCVGETAFVNG 203 >SB_22215| Best HMM Match : Rib_hydrolayse (HMM E-Value=0.035) Length = 186 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 534 SRSSQERTHARNRMAELYLGRCQYHKEFSSD 442 S S T ++ LGRC Y+KEF D Sbjct: 22 SSSGTSNTGTTRNFKDIVLGRCYYYKEFMLD 52 >SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 376 CGDSTCIERGLFCNGEKDC 432 CG+STCI + C+G DC Sbjct: 72 CGNSTCIPLTVLCDGLYDC 90 >SB_53888| Best HMM Match : TSP_3 (HMM E-Value=9.2e-11) Length = 1012 Score = 27.9 bits (59), Expect = 6.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 468 DNDPNRAPPCDSSHVSFPDCF 530 D+D ++ PPCDS H C+ Sbjct: 124 DSDRDQTPPCDSDHDQTSPCY 144 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 468 DNDPNRAPPCDSSHVSFPDCFCFQDGT 548 D+D ++ PPCDS H C D T Sbjct: 317 DSDRDQTPPCDSDHDQTSPCDSDHDQT 343 >SB_43809| Best HMM Match : PSGP (HMM E-Value=0.069) Length = 932 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 472 TTQIELRHAIPRMCPFLTASASRTA 546 TT+ E+ ++PR+ LT +ASRTA Sbjct: 398 TTKKEISKSVPRLAANLTVAASRTA 422 >SB_45248| Best HMM Match : rve (HMM E-Value=2.1e-05) Length = 809 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 540 PGSRSSQERTHARNRMAELYLGRCQYHKEFSSDPSPTVLFAVTEKTAFNASRV 382 PG SQ + +R L R QY KE +S + + +T +T ASRV Sbjct: 753 PGHHRSQAFAESFHRWLAQRLFRAQYSKELASGKTNSQC-CITRRTLSTASRV 804 >SB_28193| Best HMM Match : rve (HMM E-Value=2.1e-05) Length = 983 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -2 Query: 540 PGSRSSQERTHARNRMAELYLGRCQYHKEFSSDPSPTVLFAVTEKTAFNASRV 382 PG SQ + +R L R QY KE +S + + +T +T ASRV Sbjct: 927 PGHHRSQAFAESFHRWLAQRLFRAQYSKELASGKTNSQC-CITRRTLSTASRV 978 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,359,112 Number of Sequences: 59808 Number of extensions: 400657 Number of successful extensions: 1773 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1771 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -