BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0072 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 1.2 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.6 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 4.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 4.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 362 IILCHK*DKSDAHVEFFKNK 421 I+LC K K D V FF+ K Sbjct: 242 ILLCEKVAKEDIQVRFFEEK 261 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 362 IILCHK*DKSDAHVEFFKNK 421 I+LC K K D V FF+ K Sbjct: 242 ILLCEKVAKEDIQVRFFEEK 261 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +3 Query: 186 LFIIRVKFMNTNYNMTFTYEEALFILVFYLASIYFRLLQVGTLQINISL 332 L +IR+ +N +YNM + +F +F+L + R + ++ N L Sbjct: 332 LGLIRLIVLNLSYNMLTHIDARMFKDLFFLQILDLRNNSIDRIESNAFL 380 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/24 (29%), Positives = 18/24 (75%) Frame = -2 Query: 171 FQMRIYTVLMFKLFNIIRQWNDML 100 + ++IYT + + +N++R++ D+L Sbjct: 251 YTLKIYTHDIPETYNVVRKFRDVL 274 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/24 (29%), Positives = 18/24 (75%) Frame = -2 Query: 171 FQMRIYTVLMFKLFNIIRQWNDML 100 + ++IYT + + +N++R++ D+L Sbjct: 251 YTLKIYTHDIPETYNVVRKFRDVL 274 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,880 Number of Sequences: 438 Number of extensions: 3635 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -