BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0065 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.035 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 34 0.080 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 34 0.080 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58614| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58352| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_58007| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57897| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56954| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56879| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_56115| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55873| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55845| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55688| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54804| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54790| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54567| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54499| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54386| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54218| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_54085| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53889| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53584| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53528| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53167| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52951| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52470| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52351| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52243| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_52155| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51935| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51772| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51473| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_51166| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50890| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50848| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50784| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_50065| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49853| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49752| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49373| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49203| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_49034| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48938| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48681| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48381| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_48366| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47714| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47686| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_47543| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46918| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46892| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46860| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46695| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46385| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46375| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46256| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46190| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45354| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45337| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45243| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44997| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44632| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44443| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44357| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43924| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43592| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43485| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43398| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43168| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_43053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42602| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42357| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42118| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41902| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41894| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 34 0.080 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40838| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40537| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40477| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40428| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40402| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40306| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 34 0.080 SB_39799| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39758| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39740| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38550| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38247| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_38218| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37602| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37585| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_36939| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_36864| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_36457| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35126| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_35051| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_34359| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 36.7 bits (81), Expect = 0.011 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP+F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPDFQGSSRAHRTPQEVWC 102 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.015 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP FS ++ + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFSGASRAHRTPQEVWC 91 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 103 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 44 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 119 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 154 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 91 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 102 >SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 35.1 bits (77), Expect = 0.035 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAES 40 LETCCGY Y+ R SPEFSR+ ES Sbjct: 5 LETCCGYEYDRTR--KSMSSPEFSRAVES 31 >SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 34.7 bits (76), Expect = 0.046 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS 1 LETCCGY Y+ R SP F + + RTP ++ C R+ Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWCFYRA 44 >SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 34.7 bits (76), Expect = 0.046 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSS 7 LETCCGY Y+ R ++V PEFS+ RT +C + Sbjct: 5 LETCCGYEYDRTRKINVF--PEFSKGRRE-RTGHHKKCGA 41 >SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 34.7 bits (76), Expect = 0.046 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F ++ + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGASRAHRTPQEVWC 40 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.046 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F S+ RTP ++ C Sbjct: 106 LETCCGYEYDRTR--KSMSSPNFQGSSRVHRTPQEVWC 141 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 105 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 105 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 140 >SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 140 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 62 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 97 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 39 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 74 >SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 22 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 140 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 140 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 175 >SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 43 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 78 >SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 56 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 91 >SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 74 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 109 >SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 68 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 103 >SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 67 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 102 >SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 >SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.080 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 126 LETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 13 LETCCGY Y+ R SP F + + RTP ++ C Sbjct: 5 LETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,968,087 Number of Sequences: 59808 Number of extensions: 241959 Number of successful extensions: 2118 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1399 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -