BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0064 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0682 + 5974622-5974745,5976182-5976371,5976953-5977024,597... 31 1.0 04_03_0144 + 11796550-11797178,11797808-11797902,11798053-117981... 29 3.1 01_01_0920 + 7264498-7264573,7264705-7264745,7265339-7265408,726... 29 3.1 08_02_1540 + 27694565-27694579,27696364-27696447,27696599-276967... 29 4.1 11_04_0102 - 13491071-13491415,13491427-13491720,13491799-13492323 28 7.2 04_04_1346 + 32798825-32798900,32799027-32799070,32799163-327992... 27 9.5 >08_01_0682 + 5974622-5974745,5976182-5976371,5976953-5977024, 5977482-5977553,5977688-5977759,5977842-5977913, 5978690-5978761,5978855-5978926,5979017-5979091, 5979529-5979594,5979821-5979885,5979975-5980354, 5980438-5980636,5980713-5980763,5980955-5981073, 5981190-5981400,5981524-5981755,5981842-5981992, 5982089-5982447,5982750-5982768 Length = 890 Score = 30.7 bits (66), Expect = 1.0 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 350 LRSCRISSTISTLVQERLFSLRV-DVESNELIDSKPDIYCENFLQLFIVTAVRPLRMCTP 526 LR+C+IS + T+ +L L + D N+L S P N LQ + + + L+ TP Sbjct: 251 LRNCKISDNLRTVNFSKLGRLTLLDFSYNQLTGSFPSWVTNNNLQFILPSGLNCLQQDTP 310 >04_03_0144 + 11796550-11797178,11797808-11797902,11798053-11798102, 11798382-11799293 Length = 561 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 163 VAALLGSCQSAHLNKHIKLLSDIDNSIENGVKQNLMDLINIYRSRKAPYRR 315 +A L CQS + + L+ + +S G ++ + L+N SR + Y++ Sbjct: 307 LARLKPQCQSISDDVTVHLIQSVTSSTNTGARKEMQSLVNGLLSRSSVYQK 357 >01_01_0920 + 7264498-7264573,7264705-7264745,7265339-7265408, 7265500-7265648,7266143-7266238,7266326-7266396, 7266510-7266571,7266651-7266714,7267608-7267692, 7267777-7267903,7268016-7268080,7268739-7268796, 7268927-7269066,7269624-7269693,7269910-7269981, 7270188-7270234,7270468-7270566 Length = 463 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 288 SITQGPLPSYAHTPGTTIELTC--EAAGSPAPSVHWFKNDSSVYE 416 S +GP P+ HT T ++T A S P W K+ +YE Sbjct: 353 STERGPHPNIQHTENITQDMTARKHLAASVLPGAEWRKDGHLLYE 397 >08_02_1540 + 27694565-27694579,27696364-27696447,27696599-27696731, 27696840-27696951,27697530-27697629,27697810-27697937, 27698046-27698115,27698548-27698636,27698719-27698764, 27698854-27698924,27699002-27699075,27699341-27699433, 27699539-27699572,27699704-27699789,27702147-27702223, 27702445-27702533,27702630-27702813,27703068-27703249, 27703962-27704064,27704159-27704490,27704577-27705018, 27705749-27705846,27706988-27707081,27707666-27707787, 27708025-27708078,27708185-27708304,27708595-27708799, 27708889-27709059,27709155-27709310,27709375-27709431, 27709474-27709580,27709708-27709798,27709931-27710072, 27710149-27710305,27710400-27710516,27710596-27710722, 27710844-27711066,27711460-27711466,27711656-27711788 Length = 1574 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 249 WCQAKSDGSHKYLSITQGPLPSYAHTPG 332 WC+A+ DGS +I G YA PG Sbjct: 1278 WCRAEDDGSFCIRNIVAGDYNLYAWVPG 1305 >11_04_0102 - 13491071-13491415,13491427-13491720,13491799-13492323 Length = 387 Score = 27.9 bits (59), Expect = 7.2 Identities = 22/66 (33%), Positives = 26/66 (39%), Gaps = 3/66 (4%) Frame = +1 Query: 196 HLNKHIKLLSDIDNSIENGVKQNLMDLINIYRSRKAPYRRTH---ILPEPLLS*PAKLPD 366 H N H L D+D N L D IYR + P RR+H E L D Sbjct: 318 HYNGHPDLFRDVDI---NDAAYKLNDSRVIYRHSEVPIRRSHGKTAASEEAHQPAVSLRD 374 Query: 367 LQHHQY 384 L H Q+ Sbjct: 375 LLHFQH 380 >04_04_1346 + 32798825-32798900,32799027-32799070,32799163-32799256, 32799914-32799981,32800105-32800275 Length = 150 Score = 27.5 bits (58), Expect = 9.5 Identities = 17/87 (19%), Positives = 42/87 (48%) Frame = +2 Query: 365 ISSTISTLVQERLFSLRVDVESNELIDSKPDIYCENFLQLFIVTAVRPLRMCTPASPPRA 544 ++S + L+ R +R+D + +E I++K +I ++ + + TA + CT + Sbjct: 12 LASLLLLLLATRAHGIRLDRQLHEAINNKQEIMRDSKAEQSLNTARLMNKHCTSDGHCNS 71 Query: 545 SRLREPTLWSTIQDSASELSERAKLFR 625 +++ P + + +A + + L R Sbjct: 72 GKVQRPVVQAEAGAAAKQQQQNQSLER 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,898,363 Number of Sequences: 37544 Number of extensions: 304366 Number of successful extensions: 1007 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -