BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0061 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 0.92 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 3.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 3.7 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 4.9 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 8.6 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 8.6 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 0.92 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -2 Query: 110 KSPGASTRATCGDRLTVSVHTHRQVCPTSMLW 15 K PG S GD + + V H T++ W Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNHLSSDSTTIHW 135 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 104 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 15 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 3.7 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -2 Query: 104 PGASTRATCGDRLTVSVHTHRQVCPTSMLW 15 PG S + GD++ + V H + ++ W Sbjct: 172 PGPSIQVCEGDKVVIDVENHIEGNEVTLHW 201 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 479 NLRSCNVYWMKSLTFDKWVWVA 414 N N+Y + L FD ++W++ Sbjct: 116 NFAIFNLYMVLLLLFDAYLWIS 137 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/16 (37%), Positives = 13/16 (81%) Frame = +2 Query: 137 LTGNEVLKIVKQRLIK 184 L N++LK++++ L+K Sbjct: 392 LQQNKILKVIRKNLVK 407 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/39 (23%), Positives = 17/39 (43%) Frame = +1 Query: 25 DVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFD 141 D+G + RC C++ + S + P ++ C D Sbjct: 163 DIGNSHRCHCSDGYSGSYCQTEINECDSAPCQNGGTCLD 201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,625 Number of Sequences: 336 Number of extensions: 2899 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -