BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0058 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 22 3.7 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 4.9 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 4.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.9 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 302 PDPQIPHRTRNRH 340 PD +P RT NRH Sbjct: 110 PDNFLPERTANRH 122 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 96 KLVRCRCDKMKIKRPAVTANREKQIP 19 K R D+ ++ RPA ANR P Sbjct: 330 KRPRPNIDRHEVTRPAAPANRGNGFP 355 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 39 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 78 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +2 Query: 482 SKHSTRPPCRWHPSPCSRCTRSGRSTGIVLGLPATVSSTP 601 S H P + HPS + S STG+ + + P Sbjct: 83 STHLQSPNTQTHPSASCKYADSTSSTGVASPQDLSTNGAP 122 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,554 Number of Sequences: 336 Number of extensions: 3665 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -