BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0050 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 5.8 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 5.8 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 5.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 7.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.7 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 3 FFKREKYFHIFTNMEDIIVWNNLKLKNTLSAHVTFIQRDIF 125 FF + Y HIF+ M+ IV + TL ++ D+F Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVF 233 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 3 FFKREKYFHIFTNMEDIIVWNNLKLKNTLSAHVTFIQRDIF 125 FF + Y HIF+ M+ IV + TL ++ D+F Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVF 233 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 3 FFKREKYFHIFTNMEDIIVWNNLKLKNTLSAHVTFIQRDIF 125 FF + Y HIF+ M+ IV + TL ++ D+F Sbjct: 193 FFGKMSYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDVF 233 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 103 LSVSTSPPGKPATSTASQ 120 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 403 LSTTAAPPFKPKRITASR 456 LS + +PP KP TAS+ Sbjct: 147 LSVSTSPPGKPATSTASQ 164 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,317 Number of Sequences: 336 Number of extensions: 3952 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -