BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0050 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 5.5 AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 23 9.6 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 483 SARVGTTTLP*SSNAFRFEGR-GSRCTEILELISQD 379 S VG T+P S N FR G G ++L+ + ++ Sbjct: 384 SQDVGKVTMPGSKNVFRLYGADGHALIDLLQRVDEN 419 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 356 FTAYIRYPS*DISSKISVQRLPRPSNRNALLL 451 F+ YI+ DI+ + P P NR ++L Sbjct: 82 FSPYIKQDKKDITFSTTQDNFPTPHNRITIVL 113 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 771,797 Number of Sequences: 2352 Number of extensions: 15597 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -