BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--0050
(726 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014134-985|AAF52302.4| 3489|Drosophila melanogaster CG14001-PA... 29 8.5
>AE014134-985|AAF52302.4| 3489|Drosophila melanogaster CG14001-PA
protein.
Length = 3489
Score = 28.7 bits (61), Expect = 8.5
Identities = 22/73 (30%), Positives = 32/73 (43%)
Frame = +2
Query: 281 FFLLLRCVDKLTAHLVLSRHWNP*TFTAYIRYPS*DISSKISVQRLPRPSNRNALLLHGR 460
F+L R VDKL + + F + + SS +S++ L NR+ L L R
Sbjct: 1998 FYLTARIVDKLWQGCLARNPHDIFDFVIKLIVQAKRRSSSLSLEHLHHSLNRSILFLLSR 2057
Query: 461 VVVPTRADSHKVL 499
+RAD VL
Sbjct: 2058 PTDDSRADQMSVL 2070
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,227,176
Number of Sequences: 53049
Number of extensions: 664514
Number of successful extensions: 1287
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1258
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1287
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3252477558
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -