BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0050 (726 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077545-2|AAC26305.3| 356|Caenorhabditis elegans Hypothetical ... 33 0.16 U64858-6|AAB18283.2| 392|Caenorhabditis elegans Hypothetical pr... 29 3.4 >AF077545-2|AAC26305.3| 356|Caenorhabditis elegans Hypothetical protein H41C03.2 protein. Length = 356 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = +3 Query: 333 VDTGTHRHLQRIYATHLEI*VLRSQYNGCPALQTETHYCFTAGWWYLPVQTHIRSYHQ 506 ++T H + Y +H+ + Y C Q ET YC WW PV H+ + Q Sbjct: 295 IETAHHNSFEIFYGSHMAV----DNYKICN--QPETEYCLKGSWWKKPV-AHMYLFDQ 345 >U64858-6|AAB18283.2| 392|Caenorhabditis elegans Hypothetical protein C16D9.5 protein. Length = 392 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 551 YFSSKLESIGSIFPFYKDTGFDSGNIYLAQYFNGNIKRTF 670 +F+ SIGS++ FY + F ++ L +++ IK+ F Sbjct: 154 HFNEATHSIGSVYKFYHNAKFILYSLGLNKFYTQTIKKQF 193 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,747,016 Number of Sequences: 27780 Number of extensions: 345655 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -