BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0050 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 6.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 386 DISSKISVQRLPRPSNRNALLLHGRVVVPTRADSH 490 D S + Q P P N ++ + V PT A +H Sbjct: 1738 DPSKAMQFQTFPHPGNGHSGTMGPPVGHPTNASAH 1772 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 407 VQRLPRPSNRNALLLHGRVVVPTRADSHKV 496 V R+ +RN +LL G+ + R H V Sbjct: 33 VSRISNRISRNRVLLRGQCISSRRNGRHNV 62 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,179 Number of Sequences: 438 Number of extensions: 4430 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -