SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0047
         (652 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    23   1.6  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    21   8.8  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    21   8.8  

>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 11/79 (13%)
 Frame = +3

Query: 171 KLHWPFDCRVGHRCPTRRTEVIMSISVTRRLHGLLL-FVNVCFSLIDLL---EI------ 320
           KL W F  R GH C     + I++    R   G     +N C S + LL   E+      
Sbjct: 58  KLWWEFCQRNGHNCLDFTVQNILTFLSCRFHQGASYNTLNTCRSALALLLSPEVGKDHRI 117

Query: 321 -RFILSIVRIRLSQSLLDI 374
            RF+  + RI+ S+   D+
Sbjct: 118 KRFLRGVYRIKPSKPKYDV 136


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 535 IITVWHNVWNIRC 497
           +I  W NV NI+C
Sbjct: 602 MINQWENVTNIQC 614


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 535 IITVWHNVWNIRC 497
           +I  W NV NI+C
Sbjct: 602 MINQWENVTNIQC 614


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,321
Number of Sequences: 336
Number of extensions: 3685
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -