BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0038 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 3.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 3.3 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 23 3.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.8 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.6 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +2 Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586 +I ++ ++ W +L RN+TP Sbjct: 228 YIPSGLIVIISWVSFWLNRNATP 250 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +2 Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586 +I ++ ++ W +L RN+TP Sbjct: 228 YIPSGLIVIISWVSFWLNRNATP 250 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.6 bits (46), Expect = 3.3 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +2 Query: 518 FISEWIVDLVDWNQIYLLRNSTP 586 +I ++ ++ W +L RN+TP Sbjct: 167 YIPSGLIVIISWVSFWLNRNATP 189 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 545 PNLLSIHL*ISNRYNYEISVH 483 P LLS+HL + + E+S H Sbjct: 337 PPLLSVHLGGNAEFRCEVSTH 357 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 545 PNLLSIHL*ISNRYNYEISVH 483 P LLS+HL + + E+S H Sbjct: 337 PPLLSVHLGGNAEFRCEVSTH 357 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +2 Query: 125 ENTTWNRVKKIK*KNIAEYSLIHSYTK*EFTYN 223 ++ TW +KK N+ L+ E TYN Sbjct: 18 DSETWEAIKKDAAVNMEGQFLVRQIYDDEITYN 50 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +2 Query: 125 ENTTWNRVKKIK*KNIAEYSLIHSYTK*EFTYN 223 ++ TW +KK N+ L+ E TYN Sbjct: 18 DSETWEAIKKDAAVNMEGQFLVRQIYDDEITYN 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,157 Number of Sequences: 438 Number of extensions: 4134 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -