BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0034 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 28 0.086 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 24 1.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 24 1.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 24 1.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.1 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 1.8 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 3.2 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 3.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 3.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 3.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 3.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 3.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 3.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 3.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 3.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 3.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 3.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 3.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 3.2 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 27.9 bits (59), Expect = 0.086 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 151 QNEFRETDHFNISNDWNTNDNFCHH 77 +N R+ D+ N ND N NDN HH Sbjct: 515 RNGNRQNDNQNNQNDNNRNDNQVHH 539 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQERER 51 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/44 (22%), Positives = 22/44 (50%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++VW ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSKIDLRSRTKEERLQHRREVWLIQQERER 51 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.4 bits (48), Expect = 1.8 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = +1 Query: 193 KKMLRRQYSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDY--EKFRHGH 360 K + +R+ + + S +DRR S +PSP QD+ EK ++ H Sbjct: 9 KSLSQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSPSPSLLTSQPHQDHNKEKSKNNH 66 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQERER 51 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +1 Query: 214 YSHESGKTELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEK 345 YSH K + +++ + +D R ++ W ++Q+ E+ Sbjct: 8 YSHHDEKFKQLRNEDNKIDLRSRTKEERLQHRREAWLIQQERER 51 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,719 Number of Sequences: 438 Number of extensions: 4816 Number of successful extensions: 28 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -