BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0031 (558 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC022561-1|AAH22561.1| 396|Homo sapiens DENN/MADD domain contai... 31 3.6 AK097908-1|BAC05195.1| 213|Homo sapiens protein ( Homo sapiens ... 29 8.4 >BC022561-1|AAH22561.1| 396|Homo sapiens DENN/MADD domain containing 1B protein. Length = 396 Score = 30.7 bits (66), Expect = 3.6 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 95 QEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIER 214 Q +FS VV W +P+ F Q+ L++ +P+ P +ER Sbjct: 13 QPVFSNPVVLWKFPEDFGDQEILQS---VPKFCFPFDVER 49 >AK097908-1|BAC05195.1| 213|Homo sapiens protein ( Homo sapiens cDNA FLJ40589 fis, clone THYMU2009596. ). Length = 213 Score = 29.5 bits (63), Expect = 8.4 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 387 GQSRPGV-IGLWVLDVWHLWIRQRYKCVPRTRSMY 488 G S+P + +GLWV ++W R YKC+P R+ + Sbjct: 53 GCSQPLLKVGLWV-EMWAASGRHSYKCIPALRTTF 86 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,290,517 Number of Sequences: 237096 Number of extensions: 1936485 Number of successful extensions: 3828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3828 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -