BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0030 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 26 0.26 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 26 0.26 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 1.8 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 1.8 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.2 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.26 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 186 RTMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97 +++F F + N +FV FL+Q K I VKW Sbjct: 1267 KSVFAFFMFNALFVLVVFLLQLNKDQIHVKW 1297 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 26.2 bits (55), Expect = 0.26 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 186 RTMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97 +++F F + N +FV FL+Q K I VKW Sbjct: 1267 KSVFAFFMFNALFVLVVFLLQLNKDQIHVKW 1297 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 177 TLFLFREIKLDYIHTLFFIIICTINYKYLC 266 T++LF I+ T ++I T N YLC Sbjct: 296 TMYLFIHIRSRQEDTDTLVVIYTFNLFYLC 325 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 177 TLFLFREIKLDYIHTLFFIIICTINYKYLC 266 T++LF I+ T ++I T N YLC Sbjct: 252 TMYLFIHIRSRQEDTDTLVVIYTFNLFYLC 281 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 89 VINHLTIIFDFAYCTRNLH*TK 154 +I TI+F F YC N TK Sbjct: 262 LIQFNTIVFSFCYCYYNSKMTK 283 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,244 Number of Sequences: 336 Number of extensions: 3798 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -