BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0030 (704 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032623-8|CAA21514.1| 123|Caenorhabditis elegans Hypothetical ... 28 7.5 AF099913-3|AAC68750.1| 143|Caenorhabditis elegans Hypothetical ... 27 9.9 >AL032623-8|CAA21514.1| 123|Caenorhabditis elegans Hypothetical protein Y43F8B.7 protein. Length = 123 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 317 WRRPRSSSEMNCKTHSCA*IFVVN 246 W+ + S CKTHSC IF N Sbjct: 49 WKLSGTPSSPTCKTHSCGFIFWTN 72 >AF099913-3|AAC68750.1| 143|Caenorhabditis elegans Hypothetical protein C29F9.9 protein. Length = 143 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 513 SNWLTPKCLLP*QSYERHTYIIYVKYTNKTNGAIKV 620 +N+ P+ + Y HT ++YV Y N +G +KV Sbjct: 60 ANYSQPQFYSTIEEYSNHTSVVYVLY-NTCDGVVKV 94 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,027,112 Number of Sequences: 27780 Number of extensions: 309444 Number of successful extensions: 525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -