BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0028 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.8 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 6.5 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 8.6 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 296 TFCCSNRC----GTSCCPSSGILCCFAILCWCC 382 TF CSNRC C + + C + LC C Sbjct: 1108 TFGCSNRCFFPSKIRICWNVLLNCVYLFLCGFC 1140 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 320 RTYWSSKR 297 RTYWS+KR Sbjct: 215 RTYWSAKR 222 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 270 QQMELHRGYGRSEG 229 Q M+ +G+GRSEG Sbjct: 380 QWMQDQKGWGRSEG 393 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,407 Number of Sequences: 336 Number of extensions: 2607 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -