BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0027 (611 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 7e-27 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 7e-27 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 7e-27 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 9e-27 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 117 9e-27 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 3e-26 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 115 3e-26 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 115 3e-26 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 115 3e-26 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 114 5e-26 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 114 6e-26 SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) 114 6e-26 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 113 8e-26 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 113 8e-26 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 113 8e-26 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 113 8e-26 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 113 8e-26 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 113 8e-26 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 113 8e-26 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 113 8e-26 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 113 8e-26 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 113 8e-26 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 113 8e-26 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 113 8e-26 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 113 8e-26 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 113 8e-26 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 113 8e-26 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 113 8e-26 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 113 8e-26 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 113 8e-26 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 113 8e-26 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 113 8e-26 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 113 8e-26 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 113 8e-26 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 113 8e-26 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 113 8e-26 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 113 8e-26 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 113 8e-26 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 113 8e-26 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 113 8e-26 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 113 8e-26 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 113 8e-26 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 113 8e-26 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 113 8e-26 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 113 8e-26 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 113 8e-26 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 113 8e-26 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 113 8e-26 SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 113 8e-26 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 113 8e-26 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 8e-26 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 113 8e-26 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 113 8e-26 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 113 8e-26 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 113 8e-26 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 113 8e-26 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 113 8e-26 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 113 1e-25 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 113 1e-25 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 113 1e-25 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 113 1e-25 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 113 1e-25 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 113 1e-25 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 113 1e-25 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 113 1e-25 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 113 1e-25 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 113 1e-25 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 113 1e-25 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_17401| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 112 2e-25 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 112 2e-25 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 112 2e-25 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 112 2e-25 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 112 2e-25 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 112 2e-25 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 112 2e-25 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 112 2e-25 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 112 2e-25 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 112 2e-25 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 112 2e-25 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 112 2e-25 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 112 2e-25 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 112 2e-25 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 112 2e-25 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 112 2e-25 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 112 2e-25 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 112 2e-25 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 112 2e-25 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 112 2e-25 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 112 2e-25 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 112 2e-25 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_12058| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_11542| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_10337| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_10249| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_9501| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_9247| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_8005| Best HMM Match : Glutaredoxin (HMM E-Value=0.00023) 112 2e-25 SB_7796| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 112 2e-25 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 112 2e-25 SB_7434| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_7197| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_6942| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_6919| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_5542| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 112 2e-25 SB_4463| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_4439| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_4242| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_3474| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_2834| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_2643| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_1763| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_1485| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_1017| Best HMM Match : WCCH (HMM E-Value=7.9) 112 2e-25 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_748| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_635| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_412| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_37| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59632| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59378| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59172| Best HMM Match : SecG (HMM E-Value=9.5) 112 2e-25 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59089| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_59057| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57612| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57499| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57105| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_57057| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56866| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56805| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56511| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_56233| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55754| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55720| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_54464| Best HMM Match : DUF1566 (HMM E-Value=4.5) 112 2e-25 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53842| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53840| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53212| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53037| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 112 2e-25 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52741| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_52156| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_51524| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 112 2e-25 SB_50847| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50780| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50710| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50686| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50561| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50490| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50456| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50389| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50331| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_50064| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49959| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49504| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_48942| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_48782| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_48667| Best HMM Match : DUF488 (HMM E-Value=3.1) 112 2e-25 SB_48427| Best HMM Match : Dynactin_p22 (HMM E-Value=2.7) 112 2e-25 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 112 2e-25 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 112 2e-25 SB_47953| Best HMM Match : DUF911 (HMM E-Value=9.5) 112 2e-25 SB_47489| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_47379| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_47288| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 2e-25 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 117 bits (282), Expect = 7e-27 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 94 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 117 bits (282), Expect = 7e-27 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 104 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 117 bits (282), Expect = 7e-27 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 117 bits (281), Expect = 9e-27 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 117 bits (281), Expect = 9e-27 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 TGR LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 116 bits (278), Expect = 2e-26 Identities = 51/59 (86%), Positives = 52/59 (88%) Frame = -1 Query: 389 RLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYRANW 213 +LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF K RPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 115 bits (277), Expect = 3e-26 Identities = 60/96 (62%), Positives = 66/96 (68%) Frame = +1 Query: 133 YILDVYFFCISVIKDVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRLA 312 Y+ D Y C + DV K GG + L VLQRRDWENPGVTQLNRLA Sbjct: 1027 YVPDAYEPCKLITSDV-KPLPSGGDPLESTCRHASLALAV-VLQRRDWENPGVTQLNRLA 1084 Query: 313 AHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 420 AHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ N Sbjct: 1085 AHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 115 bits (276), Expect = 3e-26 Identities = 53/63 (84%), Positives = 53/63 (84%) Frame = -1 Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNTTHYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 645 Query: 221 ANW 213 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 115 bits (276), Expect = 3e-26 Identities = 53/63 (84%), Positives = 53/63 (84%) Frame = -1 Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 221 ANW 213 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 115 bits (276), Expect = 3e-26 Identities = 53/63 (84%), Positives = 53/63 (84%) Frame = -1 Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYR 222 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW GF K RPVNCNTTHYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYR 88 Query: 221 ANW 213 ANW Sbjct: 89 ANW 91 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 114 bits (275), Expect = 5e-26 Identities = 55/92 (59%), Positives = 68/92 (73%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKF 435 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 37 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHL 96 Query: 436 ALNFC*ISSFFNQ*AEIGKIPYKSKNRPEIGL 531 + S F Q + + ++ S++ +G+ Sbjct: 97 CASTEIPRSTFTQASSVQRLFGTSQDDAGVGV 128 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 114 bits (274), Expect = 6e-26 Identities = 51/62 (82%), Positives = 55/62 (88%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKF 435 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 836 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHL 895 Query: 436 AL 441 L Sbjct: 896 IL 897 >SB_31939| Best HMM Match : 7tm_2 (HMM E-Value=0.63) Length = 187 Score = 114 bits (274), Expect = 6e-26 Identities = 58/87 (66%), Positives = 60/87 (68%), Gaps = 3/87 (3%) Frame = +1 Query: 151 FFCISVIK---DVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRLAAHP 321 FFCI ++ R QFAL VLQRRDWENPGVTQLNRLAAHP Sbjct: 61 FFCIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHP 120 Query: 322 PFASWRNSEEARTDRPSQQLRSLNGEW 402 PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEW 147 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 28 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 52 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 31 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 117 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 14 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 25 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 156 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 50 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 106 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 63 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 216 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 43 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 78 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 25 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 113 bits (273), Expect = 8e-26 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLK 432 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ + K Sbjct: 103 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 76 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 31 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 62 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 103 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 128 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 99 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 64 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 87 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 87 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 87 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 68 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 27 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 111 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 27 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 46 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 79 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 70 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 94 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 137 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 185 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 62 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 149 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 61 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 119 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 26 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 655 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 164 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 25 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 188 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 447 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 76 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 269 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 37 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 73 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 107 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 66 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 76 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 76 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 77 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 86 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 179 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 34 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 86 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 52 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 71 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 41 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 90 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 107 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 41 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 53 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 52 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 129 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 58 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 57 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 91 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 58 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 97 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 68 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 170 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 82 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 60 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 108 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 39 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 122 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 155 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 105 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 37 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 129 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 29 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 74 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 88 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 96 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 75 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 96 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 110 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 111 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 309 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 55 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 18 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 29 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 59 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 250 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 >SB_44012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 113 bits (273), Expect = 8e-26 Identities = 60/97 (61%), Positives = 64/97 (65%), Gaps = 10/97 (10%) Frame = +1 Query: 142 DVYFFCISVIKDVYKRRLEGGPGT----------QFAL**VVLQFTGRVLQRRDWENPGV 291 D+YF C+ K + GG + QFAL VLQRRDWENPGV Sbjct: 40 DLYFVCLMTPKSTIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGV 99 Query: 292 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 100 TQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 84 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 51 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 27 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 207 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 66 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 722 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 42 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 190 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 118 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 33 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 88 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 35 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 112 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 24 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 63 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 24 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 70 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 47 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 65 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 124 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 72 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 367 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 44 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 57 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 113 bits (273), Expect = 8e-26 Identities = 50/57 (87%), Positives = 54/57 (94%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 440 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 496 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 113 bits (272), Expect = 1e-25 Identities = 50/60 (83%), Positives = 54/60 (90%) Frame = +1 Query: 247 TGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNIL 426 TGR RRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ +L Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 32 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 21 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 22 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 40 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 135 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 24 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 36 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 149 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 1193 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 82.6 bits (195), Expect = 2e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 401 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 294 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 80 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 34 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 37 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 39 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 24 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 20 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 34 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 173 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 22 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 50 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 35 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 61 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 20 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 63 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 68.1 bits (159), Expect = 5e-12 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 304 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 399 +++AHPPFASWRNSEEARTDRPSQQLRSLNGE Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 64 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 20 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 76 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 145 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 194 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 44 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 25 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 46 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 21 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 61 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 65 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 45 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 20 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 36 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 37 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 49 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 29 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 58 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 59 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 159 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 210 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 61 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 92 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 21 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 47 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 98 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 148 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 794 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 845 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 58 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 33 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 84 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 56 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 107 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 21 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 38 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 89 >SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 113 bits (272), Expect = 1e-25 Identities = 58/91 (63%), Positives = 62/91 (68%), Gaps = 3/91 (3%) Frame = +1 Query: 139 LDVYFFCISVIK---DVYKRRLEGGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRL 309 L++ FCI ++ R QFAL VLQRRDWENPGVTQLNRL Sbjct: 9 LNMIVFCIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRL 68 Query: 310 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 69 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 532 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 583 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 40 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 14 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 201 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 252 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 54 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 105 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 30 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 81 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 27 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 78 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 43 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 23 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 39 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 113 bits (272), Expect = 1e-25 Identities = 49/52 (94%), Positives = 52/52 (100%) Frame = +1 Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIV 411 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+++ Sbjct: 19 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,605,038 Number of Sequences: 59808 Number of extensions: 408752 Number of successful extensions: 5019 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5006 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -