BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0027 (611 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g03080.1 68414.m00282 kinase interacting family protein simil... 29 3.2 At1g80210.1 68414.m09387 expressed protein 27 7.4 At1g75520.1 68414.m08776 lateral root primordium (LRP) protein-r... 27 7.4 At1g27020.1 68414.m03294 expressed protein 27 7.4 At5g33210.1 68418.m03923 zinc finger protein-related similar to ... 27 9.8 At3g51060.1 68416.m05591 zinc finger protein, putative / lateral... 27 9.8 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 28.7 bits (61), Expect = 3.2 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 516 TRDRVECCSSLEQESTIKERGLQRQRAK 599 T + VE C +LE ST+K+R +++ + + Sbjct: 1344 TNELVEACKNLESRSTLKDREIEQLKGR 1371 >At1g80210.1 68414.m09387 expressed protein Length = 354 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 335 QLAKGGCAARRLSWVTPGFSQSRRCKTRPVNCNTTHYRANWVPGPPSS 192 + +K G +A + W S+S R K R + N +Y +W+ PSS Sbjct: 30 EYSKDGGSATAMIWGASPQSRSDRQKDRNDDINGQNYTGHWMVPLPSS 77 >At1g75520.1 68414.m08776 lateral root primordium (LRP) protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702) Length = 346 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRRL 183 CK+R +C T H ++ WVP RL Sbjct: 145 CKSRGFHCQT-HVKSTWVPAAKRRERL 170 >At1g27020.1 68414.m03294 expressed protein Length = 308 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 274 WENPGVTQLNRLAAHPPFASW 336 WE P T N+LA FA+W Sbjct: 163 WEKPTSTDFNQLAKESEFAAW 183 >At5g33210.1 68418.m03923 zinc finger protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702), TIGR01623: putative zinc finger domain, LRP1 type Length = 173 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRR 186 CK+R C+T H R+ WVP R Sbjct: 72 CKSRGFECST-HVRSTWVPATKRRER 96 >At3g51060.1 68416.m05591 zinc finger protein, putative / lateral root primordium (LRP) protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702) Length = 252 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 263 CKTRPVNCNTTHYRANWVPGPPSSRR 186 CK+R C+T H R+ WVP R Sbjct: 164 CKSRGFECST-HVRSTWVPAAKRRER 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,523,567 Number of Sequences: 28952 Number of extensions: 276854 Number of successful extensions: 602 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -