BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0023 (531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.2 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 2.9 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 5.1 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 216 GHAVGDIPGVR 184 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = +1 Query: 361 LASTPTFSRGGPVPIRPIVSRITIHWPSFYNR 456 +++ PT S+ +P+ + + +PS+YN+ Sbjct: 336 ISAQPTPSQSPNQIYQPVTNLTNLTYPSYYNQ 367 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +3 Query: 102 CTPMILVAPFSLCRERGET 158 C P + V P C E G T Sbjct: 163 CDPAVCVLPDCFCSEDGTT 181 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,201 Number of Sequences: 336 Number of extensions: 2584 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -