BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0023 (531 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 95 3e-20 SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 91 4e-19 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 5e-11 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 60 1e-09 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 60 1e-09 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 60 1e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 4e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 4e-09 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 54 1e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 48 5e-06 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 47 1e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 3e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 45 3e-05 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 38 0.007 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 37 0.009 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 37 0.009 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.063 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.083 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) 33 0.11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 32 0.25 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 32 0.25 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 32 0.33 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 31 0.77 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) 31 0.77 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 30 1.0 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 30 1.4 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 29 1.8 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 29 1.8 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 1.8 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 29 1.8 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 29 2.4 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 29 2.4 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 29 2.4 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 29 2.4 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 29 3.1 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 28 4.1 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 4.1 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 28 4.1 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 4.1 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 28 4.1 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.1 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 28 4.1 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 28 4.1 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 28 4.1 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 28 4.1 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 28 4.1 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 28 4.1 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 28 4.1 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 4.1 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 28 4.1 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 28 4.1 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 28 4.1 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 28 4.1 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 4.1 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 28 4.1 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 28 4.1 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 28 4.1 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 4.1 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 28 4.1 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 28 4.1 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 28 4.1 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 28 4.1 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 28 4.1 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 28 4.1 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 28 4.1 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 28 4.1 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 28 4.1 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 28 4.1 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 4.1 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 28 4.1 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 28 4.1 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 28 4.1 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 4.1 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 28 4.1 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 28 4.1 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 28 4.1 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 28 4.1 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 28 4.1 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 28 4.1 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 28 4.1 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 28 4.1 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 28 4.1 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 28 4.1 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 4.1 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 28 4.1 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 28 4.1 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 28 4.1 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 28 4.1 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 28 4.1 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 95.1 bits (226), Expect = 3e-20 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = -1 Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112 +NDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 96 ENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 84.2 bits (199), Expect = 6e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 383 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252 ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IE+ Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 96 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 91.5 bits (217), Expect = 4e-19 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = -2 Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252 G LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IE+ Sbjct: 48 GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEE 95 Score = 48.0 bits (109), Expect = 5e-06 Identities = 18/23 (78%), Positives = 23/23 (100%) Frame = -1 Query: 255 KNDEVLVAGFGRKGHAVGDIPGV 187 +NDEVL++GFGR+GHAVGDIPG+ Sbjct: 95 ENDEVLISGFGRRGHAVGDIPGI 117 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 64.5 bits (150), Expect = 5e-11 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -1 Query: 519 EKGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 EKGDVLQ L G + FP VVKRRPVNCNTTHYRANW Sbjct: 63 EKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.1 bits (144), Expect = 3e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 403 IRPIVSRITIHWPSFYNRRDWENPGV 480 IRPIVSRITIHWPSFY RRDWENPGV Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGV 43 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 KG RRLSWG FP VVKRRPVNCNTTHYRANW Sbjct: 614 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 KG RRLSWG FP VVKRRPVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 KG RRLSWG FP VVKRRPVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWG----FPSHDVVKRRPVNCNTTHYRANW 91 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 58.0 bits (134), Expect = 4e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 + + GNA VFP VVKRRPVNCNTTHYRANW Sbjct: 21 KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.0 bits (134), Expect = 4e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 + + GNA VFP VVKRRPVNCNTTHYRANW Sbjct: 35 KAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 57.6 bits (133), Expect = 6e-09 Identities = 27/39 (69%), Positives = 27/39 (69%) Frame = -1 Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 KG RRLSW FP VVKRRPVNCNTTHYRANW Sbjct: 43 KGGCAARRLSWVTPG-FPSHDVVKRRPVNCNTTHYRANW 80 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 56.4 bits (130), Expect = 1e-08 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 + + GNA+ FP VVKRRPVNCNTTHYRANW Sbjct: 27 KAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 53.6 bits (123), Expect = 1e-07 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 + + +A VFP VVKRRPVNCNTTHYRANW Sbjct: 29 KSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -1 Query: 480 NARVFPVTTVVKRRPVNCNTTHYRANW 400 +A VFP VVKRRPVNCNTTHYRANW Sbjct: 33 HAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 52.0 bits (119), Expect = 3e-07 Identities = 22/32 (68%), Positives = 22/32 (68%) Frame = -1 Query: 495 RLSWGNARVFPVTTVVKRRPVNCNTTHYRANW 400 R W FP VVKRRPVNCNTTHYRANW Sbjct: 49 RNCWEGRSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 51.6 bits (118), Expect = 4e-07 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -1 Query: 471 VFPVTTVVKRRPVNCNTTHYRANW 400 VFP VVKRRPVNCNTTHYRANW Sbjct: 1876 VFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -1 Query: 468 FPVTTVVKRRPVNCNTTHYRANW 400 FP VVKRRPVNCNTTHYRANW Sbjct: 2 FPSHDVVKRRPVNCNTTHYRANW 24 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRAN 403 + + GNA VF VVKRRPVNCNTTHYRAN Sbjct: 9 KAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +1 Query: 415 VSRITIHWPSFYNRRDWENPGVT 483 +SRITIHWPS RRDWENPGVT Sbjct: 277 LSRITIHWPSVLQRRDWENPGVT 299 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 48.0 bits (109), Expect = 5e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPVNCNTTHYRAN 403 + + GNAR FP KRRPVNCNTTHYRAN Sbjct: 66 KAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVT 483 SRITIHWPSFYN WENPGVT Sbjct: 2 SRITIHWPSFYNVVHWENPGVT 23 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 453 VVKRRPVNCNTTHYRANW 400 VVKRRPVNCNTTHYRANW Sbjct: 4 VVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 453 VVKRRPVNCNTTHYRANW 400 VVKRRPVNCNTTHYRANW Sbjct: 4 VVKRRPVNCNTTHYRANW 21 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 391 GPVPIRPIVSRITIHWPSFYN 453 G PIRPIVSRITIHWP+FYN Sbjct: 36 GGAPIRPIVSRITIHWPAFYN 56 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F TGKTLA QLNRL + PF+ Sbjct: 54 FYNAPTGKTLAYTQLNRLAAHPPFA 78 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 45.2 bits (102), Expect = 3e-05 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 283 GTNAVTFFPFLMS-CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN 453 GT A T P + + + + G S+ + G PIRPIVS ITIHWPSFYN Sbjct: 1 GTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATVGGAPIRPIVSHITIHWPSFYN 58 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516 SRITIHWPSFYN +N G P+ LQ+IPL Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPL 34 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 403 IRPIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516 +RP+VSRITIHW SFYN + + P LQHIPL Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLAL-PNLIALQHIPL 69 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.7 bits (91), Expect = 7e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVT 483 SRITIHWPSFYN +NPGVT Sbjct: 2 SRITIHWPSFYNVVTGKNPGVT 23 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGK + QLNRL + PF+ Sbjct: 11 FYNVVTGKNPGVTQLNRLAAHPPFA 35 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/36 (55%), Positives = 23/36 (63%) Frame = +1 Query: 409 PIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516 P +SRITIHWPSFYN + + P LQHIPL Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 111 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +2 Query: 431 FTGRRFTTVVTGKTLALPQL 490 +TGRRFTT+VTGKTLALP L Sbjct: 54 WTGRRFTTLVTGKTLALPNL 73 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 37.5 bits (83), Expect = 0.007 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 364 ASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVTPT*SPLQHIP 513 A++ +F V I+ I+ WPS YN RDW N GVT + H+P Sbjct: 195 AASTSFLANREVNIQDIMKSAGC-WPSIYNDRDWNNSGVTQLNRLVAHLP 243 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVT 483 SRITIHWPSFYN +N GVT Sbjct: 2 SRITIHWPSFYNVVTGKNTGVT 23 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGK + QLNRL + PF+ Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFA 35 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVT 483 SRITIHWPSFYN + PGVT Sbjct: 2 SRITIHWPSFYNVMLAKTPGVT 23 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVT 483 SRITIHWPSFYN +N GVT Sbjct: 2 SRITIHWPSFYNVVTGKNTGVT 23 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGK + QLNRL + PF+ Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPFA 35 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 37.1 bits (82), Expect = 0.009 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 10/68 (14%) Frame = +1 Query: 310 FLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RR 459 F C R RM + C + + S G P+ + R + + P S+YN RR Sbjct: 141 FYKGCHRCECRMEGINCEVGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRR 200 Query: 460 DWENPGVT 483 DWENPGVT Sbjct: 201 DWENPGVT 208 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516 SRITIHWPSFYN + + P LQHIPL Sbjct: 2 SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 33 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPL 516 SRITIHWPSFYN + + P LQHIPL Sbjct: 2 SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPL 33 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 36.7 bits (81), Expect = 0.012 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPLF 519 SRITIHWPSFYN + + P LQHIP F Sbjct: 2 SRITIHWPSFYNVVTGKTLAL-PNLIALQHIPPF 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGKTLALP L L PF+ Sbjct: 11 FYNVVTGKTLALPNLIALQHIPPFA 35 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.7 bits (81), Expect = 0.012 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = +1 Query: 418 SRITIHWPSFYNRRDWENPGVTPT*SPLQHIPLF 519 SRITIHWPSFYN + + P L+HIPL+ Sbjct: 2 SRITIHWPSFYNVVTGKTLAL-PNLFDLRHIPLY 34 >SB_26800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 34.3 bits (75), Expect = 0.063 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +2 Query: 434 TGRRFTTVVTGKTLALPQLNRL 499 TGRR VVTGKTLA+P LN L Sbjct: 8 TGRRVYDVVTGKTLAVPSLNAL 29 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.9 bits (74), Expect = 0.083 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGKTL++ QLNRL + PF+ Sbjct: 11 FYNVVTGKTLSVTQLNRLAAHPPFA 35 Score = 32.7 bits (71), Expect = 0.19 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 418 SRITIHWPSFYN 453 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGKTL + QLNRL + PF+ Sbjct: 9 FYNVVTGKTLGVTQLNRLAAHPPFA 33 >SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) Length = 302 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -2 Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVP 282 K+PNSA RKC ++L NGK ++A++P Sbjct: 242 KKPNSAQRKCALLKL-SNGKTISAYIP 267 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 32.7 bits (71), Expect = 0.19 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 418 SRITIHWPSFYN 453 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGKTLALP L L + PF+ Sbjct: 11 FYNVVTGKTLALPNLIALAAHPPFA 35 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 32.7 bits (71), Expect = 0.19 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 418 SRITIHWPSFYN 453 SRITIHWPSFYN Sbjct: 2 SRITIHWPSFYN 13 Score = 29.1 bits (62), Expect = 2.4 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 446 FTTVVTGKTLALPQLNRLCSTSPFS 520 F VVTGKTLALP L L PF+ Sbjct: 11 FYNVVTGKTLALPNLIALQLHPPFA 35 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 7/25 (28%) Frame = +1 Query: 430 IHWPSFYN-------RRDWENPGVT 483 IH+ S+YN RRDWENPGVT Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVT 1488 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 32.3 bits (70), Expect = 0.25 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 7/72 (9%) Frame = +1 Query: 289 NAVTFFPF-------LMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSF 447 N V+F+PF L+ T HLR L + P G P+ ++ Sbjct: 72 NQVSFYPFVLHEISVLIELTLGHLRY-RLTDVPPQPNSQPDGD-PLESTCRHASLALAVV 129 Query: 448 YNRRDWENPGVT 483 RRDWENPGVT Sbjct: 130 LQRRDWENPGVT 141 >SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 32.3 bits (70), Expect = 0.25 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Frame = +1 Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 H + E+ L S+ G P+ + R + + P S+YN RRDWENPGVT Sbjct: 152 HFKSYEINSLRSSKPIDPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 211 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 31.9 bits (69), Expect = 0.33 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 7/32 (21%) Frame = +1 Query: 409 PIVSRITIHWPSFYN-------RRDWENPGVT 483 P V + + H S+YN RRDWENPGVT Sbjct: 46 PFVPKSSRHSESYYNSLAVVLQRRDWENPGVT 77 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.5 bits (68), Expect = 0.44 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +1 Query: 283 GTNAVTFFPFLMS-CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRR 459 GT A T P + + + + G S+ + G PIRP R Sbjct: 14 GTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAGGAPIRPYSESYYSSLAVGLQRL 73 Query: 460 DWENPGVTP 486 DW+NPGVTP Sbjct: 74 DWKNPGVTP 82 >SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 10/47 (21%) Frame = +1 Query: 373 PTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 P F GG R + + + + S+YN RRDWENPGVT Sbjct: 106 PIFKPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 152 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPV 433 + + GNARVFP VVKRRPV Sbjct: 4 KAIKLGNARVFPSHDVVKRRPV 25 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 516 KGDVLQRRLSWGNARVFPVTTVVKRRPV 433 KG RRLSWG FP VVKRRPV Sbjct: 44 KGGCAARRLSWG----FPSHDVVKRRPV 67 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.1 bits (67), Expect = 0.58 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 10/59 (16%) Frame = +1 Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 L E GC S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 69 LYACEAGCQYEPVELSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 127 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.1 bits (67), Expect = 0.58 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 G + S +F P+ ++ RRDWENPGVT Sbjct: 80 GIVVSRSSFGMASGDPLESTCRHASLALAVVLQRRDWENPGVT 122 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.1 bits (67), Expect = 0.58 Identities = 24/66 (36%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +1 Query: 307 PFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDW 465 P L CT HL + C P P P S + + S+YN RRDW Sbjct: 43 PLLSPCTPPHLSPSN-SCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDW 97 Query: 466 ENPGVT 483 ENPGVT Sbjct: 98 ENPGVT 103 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 0.77 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 12/71 (16%) Frame = +1 Query: 307 PFLMSCTRTHLRMAEL--GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN------ 453 P + T HL A L G ++ + S G P+ + R + + P S+YN Sbjct: 31 PKVSDSTHVHLEPAFLAEGFRVASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVL 90 Query: 454 -RRDWENPGVT 483 RRDWENPGVT Sbjct: 91 QRRDWENPGVT 101 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 30.7 bits (66), Expect = 0.77 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 10/62 (16%) Frame = +1 Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477 R R+A L C + + + S G P+ + R + + P S+YN RRDWENPG Sbjct: 17 RQRTRVASL-CRSRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 75 Query: 478 VT 483 VT Sbjct: 76 VT 77 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 30.7 bits (66), Expect = 0.77 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 10/61 (16%) Frame = +1 Query: 331 THLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGV 480 +H+ + L S+ + S G P+ + R + + P S+YN RRDWENPGV Sbjct: 2 SHMTYVTIHVLNSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGV 61 Query: 481 T 483 T Sbjct: 62 T 62 >SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 10/56 (17%) Frame = +1 Query: 346 AELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 AE+ ++S GG R + + + + S+YN RRDWENPGVT Sbjct: 55 AEIAEISSIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 110 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 30.7 bits (66), Expect = 0.77 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +1 Query: 349 ELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 ELG SR G P+ ++ RRDWENPGVT Sbjct: 27 ELGTQCVAAHSSRSGD-PLESTCRHASLALAVVLQRRDWENPGVT 70 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 0.77 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 10/52 (19%) Frame = +1 Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 C +S+ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 3 CASSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54 >SB_14546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.7 bits (66), Expect = 0.77 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 10/42 (23%) Frame = +1 Query: 388 GGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 GG R +V+ + + + S+YN RRDWENPGVT Sbjct: 15 GGSTSSRAVVTAVELQFALYESYYNSLAVVLQRRDWENPGVT 56 >SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) Length = 159 Score = 30.7 bits (66), Expect = 0.77 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 16/72 (22%) Frame = +1 Query: 316 MSCTRTHLRMAEL--GCLAST----PTFSRGGPVPIRPIVSRITIHWP---SFYN----- 453 ++C H+ + L C AS P S G P+ + R + + P S+YN Sbjct: 13 IACRENHVEVVRLLLDCGASVNAPFPNSSPGDPLVLERPPPRWSSNSPYSESYYNSLAVV 72 Query: 454 --RRDWENPGVT 483 RRDWENPGVT Sbjct: 73 LQRRDWENPGVT 84 >SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 445 FYNRRDWENPGVT 483 F RRDWENPGVT Sbjct: 19 FLQRRDWENPGVT 31 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +1 Query: 328 RTHLRMAELGCLASTPTFSRGGPV-----PIRPIVSRITIHWPSFYNRRDWENPGVT 483 + H E G S P R P+ P+ ++ RRDWENPGVT Sbjct: 3 KRHASRREKGGQVSEPNLLREIPILLPGDPLESTCRHASLALAVVLQRRDWENPGVT 59 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 10/52 (19%) Frame = +1 Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 C+ ++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 87 CIVTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 138 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 445 FYNRRDWENPGVT 483 F RRDWENPGVT Sbjct: 68 FLQRRDWENPGVT 80 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 445 FYNRRDWENPGVT 483 F RRDWENPGVT Sbjct: 11 FLQRRDWENPGVT 23 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = +1 Query: 409 PIVSRITIHWPSF---YNRRDWENPGVT 483 P++ R+ ++ S RRDWENPGVT Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVT 77 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 349 ELGCLASTPTFSRGGPV-PIRPIVSRITIHWPSFYNRRDWENPGVT 483 EL L T ++GG P+ ++ RRDWENPGVT Sbjct: 39 ELNRLLHGVTIAQGGVGDPLESTCRHASLALAVVLQRRDWENPGVT 84 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = +1 Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 G L+ + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 58 GALSQSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 110 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 10/59 (16%) Frame = +1 Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 L L CL S + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 6 LSFLPLPCLRSN-SCSPGDPLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 63 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 448 YNRRDWENPGVT 483 + RRDWENPGVT Sbjct: 44 FTRRDWENPGVT 55 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 7/74 (9%) Frame = +1 Query: 283 GTNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN--- 453 G N + F L++ + + L + P S + + ++ S+YN Sbjct: 10 GINIIAIFTALVTASVSASTRPYFNILGAKPGGSTSSRAAATAVELQFALY-ESYYNSLA 68 Query: 454 ----RRDWENPGVT 483 RRDWENPGVT Sbjct: 69 VVLQRRDWENPGVT 82 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 385 RGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 RGG P+ ++ RRDWENPGVT Sbjct: 84 RGGD-PLESTCRHASLALAVVLQRRDWENPGVT 115 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 373 PTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 PT G P+ ++ RRDWENPGVT Sbjct: 39 PTIKASGD-PLESTCRHASLALAVVLQRRDWENPGVT 74 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 10/59 (16%) Frame = +1 Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 +R + C + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 46 MRSPDAHCRVPSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 104 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +1 Query: 346 AELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 AE G L F RG P + ++ RRDWENPGVT Sbjct: 38 AEQGRL-DVEAFGRGDP--LESTCRHASLALAVVLQRRDWENPGVT 80 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 428 VIRLTIG-RIGTGPPLEKVGVEAKQPNSAIRK 336 +I IG + GTGPPLE G++ P +A K Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDPEAAFEK 39 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 110 RRDWENPGVT 119 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 10/62 (16%) Frame = +1 Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477 + H R +A++ + S G P+ + R + + P S+YN RRDWENPG Sbjct: 67 KVHCRKQRSREVATSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 126 Query: 478 VT 483 VT Sbjct: 127 VT 128 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 373 PTFSRGGPVPIR-PIVS---RITIHWPSFYNRRDWENPGVT 483 PTF+ +PI P+ S ++ RRDWENPGVT Sbjct: 5 PTFADNDTLPIGDPLESTCRHASLALAVVLQRRDWENPGVT 45 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = +1 Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 G AS+ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 47 GGTASSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 99 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 Query: 528 SWPEKGDVLQRRLSW 484 SW KGDVLQRRLSW Sbjct: 19 SW-RKGDVLQRRLSW 32 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 454 RRDWENPGVTPT*SPLQHIPLFR 522 RRDWENPGVT H P R Sbjct: 71 RRDWENPGVTQLNRLAAHPPFAR 93 >SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 10/52 (19%) Frame = +1 Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 C+ ++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 2 CIFASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 53 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 454 RRDWENPGVTPT*SPLQHIPLFR 522 RRDWENPGVT H P R Sbjct: 71 RRDWENPGVTQLNRLAAHPPFAR 93 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%) Frame = +1 Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 LG L + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 22 LGSLIISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 75 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 FS+ P+ ++ RRDWENPGVT Sbjct: 1 FSKVSGDPLESTCRHASLALAVVLQRRDWENPGVT 35 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 F+ G P+ ++ RRDWENPGVT Sbjct: 38 FAGEGGDPLESTCRHASLALAVVLQRRDWENPGVT 72 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 382 SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 S+G P+ ++ RRDWENPGVT Sbjct: 1172 SQGKGDPLESTCRHASLALAVVLQRRDWENPGVT 1205 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 433 HWPSFYNRRDWENPGVTPT*SPLQHIPLF 519 HWPSFYN + + P LQHIP F Sbjct: 5 HWPSFYNDVTGKTLAL-PNLIALQHIPTF 32 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = +1 Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 G L ++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 75 GILLTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 127 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 10/69 (14%) Frame = +1 Query: 307 PFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------R 456 P S H+ + C S T S G P+ + R + + P S+YN R Sbjct: 150 PHYASTAHAHMHLPWPLCPYSGST-SPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQR 208 Query: 457 RDWENPGVT 483 RDWENPGVT Sbjct: 209 RDWENPGVT 217 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +1 Query: 364 ASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 A ++GG P+ ++ RRDWENPGVT Sbjct: 79 AHAADLAKGGD-PLESTCRHASLALAVVLQRRDWENPGVT 117 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 370 TPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 TP +R P+ ++ RRDWENPGVT Sbjct: 134 TPQENRYEGDPLESTCRHASLALAVVLQRRDWENPGVT 171 >SB_2903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 10/64 (15%) Frame = +1 Query: 322 CTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWEN 471 C + +L + L C GG R + + + + S+YN RRDWEN Sbjct: 22 CCKVYLNVNVL-CPVLIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWEN 80 Query: 472 PGVT 483 PGVT Sbjct: 81 PGVT 84 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 29.1 bits (62), Expect = 2.4 Identities = 22/66 (33%), Positives = 27/66 (40%) Frame = +1 Query: 286 TNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDW 465 TN+ F++S H MA L T T VP ++ RRDW Sbjct: 747 TNSCWETDFVISIDAKHDNMAFSRSLPFTVT------VPSESTCRHASLALAVVLQRRDW 800 Query: 466 ENPGVT 483 ENPGVT Sbjct: 801 ENPGVT 806 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 455 VVTGKTLALPQLNRLCSTSPFS 520 VVTGKT + QLNRL + PF+ Sbjct: 14 VVTGKTPGVTQLNRLAAHPPFA 35 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 7/59 (11%) Frame = +1 Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDWENPGVT 483 R H+ A C P P P S + + S+YN RRDWENPGVT Sbjct: 8 RPHIHRASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 62 >SB_35709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 10/58 (17%) Frame = +1 Query: 340 RMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 R+ +L L GG R + + + + S+YN RRDWENPGVT Sbjct: 15 RLPKLDALRWIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 72 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 10/51 (19%) Frame = +1 Query: 361 LASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 L+S+ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 12 LSSSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 62 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 498 RRLSWGNARVFPVTTVVKRRPV 433 + + GNA VFP VVKRRPV Sbjct: 4 KAIKLGNASVFPSHDVVKRRPV 25 >SB_28018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 10/59 (16%) Frame = +1 Query: 337 LRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 L + + GCL GG R + + + + S+YN RRDWENPGVT Sbjct: 17 LTVGKKGCLIEF--LQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 73 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 10/54 (18%) Frame = +1 Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 L C A + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 3 LFCEAVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 56 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Frame = +1 Query: 355 GCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 G A++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 17 GICAASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 69 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = +1 Query: 349 ELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 ELG LA GG P+ ++ RRDWENPGVT Sbjct: 27 ELGTLA-LHRLDVGGD-PLESTCRHASLALAVVLQRRDWENPGVT 69 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.1 bits (62), Expect = 2.4 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 7/73 (9%) Frame = +1 Query: 286 TNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN---- 453 T VT F+ + + + A C P P P S + + S+YN Sbjct: 13 TRRVTVITFVHTTSYLTIHSASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAV 68 Query: 454 ---RRDWENPGVT 483 RRDWENPGVT Sbjct: 69 VLQRRDWENPGVT 81 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 10/52 (19%) Frame = +1 Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 C ++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 7 CYKTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 58 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 382 SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 SR G P+ ++ RRDWENPGVT Sbjct: 11 SRNGD-PLESTCRHASLALAVVLQRRDWENPGVT 43 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 367 STPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 S PT + G P+ ++ RRDWENPGVT Sbjct: 2 SPPTPTATGD-PLESTCRHASLALAVVLQRRDWENPGVT 39 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 LG ++ P G P + ++ RRDWENPGVT Sbjct: 32 LGICSAGPIQKEGDP--LESTCRHASLALAVVLQRRDWENPGVT 73 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 28.7 bits (61), Expect = 3.1 Identities = 23/74 (31%), Positives = 29/74 (39%), Gaps = 15/74 (20%) Frame = +1 Query: 307 PFLMSCTRTHL--RMAELGC---LASTPTFSRGGPVPIRPIVSRITIH---WPSFYN--- 453 P SC HL R C + GG R + + + + S+YN Sbjct: 19 PITKSCCHGHLYIRATHACCHDKVVKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLA 78 Query: 454 ----RRDWENPGVT 483 RRDWENPGVT Sbjct: 79 VVLQRRDWENPGVT 92 >SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 10/45 (22%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 FS G P+ + R + + P S+YN RRDWENPGVT Sbjct: 326 FSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 370 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 F R P+ ++ RRDWENPGVT Sbjct: 107 FQRDQGDPLESTCRHASLALAVVLQRRDWENPGVT 141 >SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 7/26 (26%) Frame = +1 Query: 427 TIHWPSFYN-------RRDWENPGVT 483 TI S+YN RRDWENPGVT Sbjct: 55 TIRPESYYNSLAVVLQRRDWENPGVT 80 >SB_52743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 10/51 (19%) Frame = +1 Query: 361 LASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 L+S GG R + + + + S+YN RRDWENPGVT Sbjct: 48 LSSIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 98 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 382 SRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 ++GG P+ ++ RRDWENPGVT Sbjct: 36 AKGGD-PLESTCRHASLALAVVLQRRDWENPGVT 68 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 10/52 (19%) Frame = +1 Query: 358 CLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 C+ + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 3 CMLVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 10/54 (18%) Frame = +1 Query: 352 LGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 +G + ++ + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 1 MGTVQASNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 54 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 7/57 (12%) Frame = +1 Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWPSFYN-------RRDWENPGVT 483 HL+ A C P P P S + + S+YN RRDWENPGVT Sbjct: 22 HLQAASNSCSPGDPLVLERPP----PRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 74 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 3.1 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 10/65 (15%) Frame = +1 Query: 319 SCTRTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWE 468 SC HLR L ++ + S G P+ + R + + P S+YN RRDWE Sbjct: 50 SCEVIHLR--SLYFPETSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWE 107 Query: 469 NPGVT 483 NPGVT Sbjct: 108 NPGVT 112 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 F R P+ ++ RRDWENPGVT Sbjct: 18 FHRSTGDPLESTCRHASLALAVVLQRRDWENPGVT 52 >SB_19616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 10/60 (16%) Frame = +1 Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 H M E+ + GG R + + + + S+YN RRDWENPGVT Sbjct: 186 HGTMKEVRWTSGIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 245 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 10/51 (19%) Frame = +1 Query: 361 LASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 LA + + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 14 LAGSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 64 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 10/62 (16%) Frame = +1 Query: 328 RTHLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPG 477 R +R+ C + + S G P+ + R + + P S+YN RRDWENPG Sbjct: 18 RLRVRLRYRICRERSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPG 77 Query: 478 VT 483 VT Sbjct: 78 VT 79 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +1 Query: 322 CTRTHLRMAELGCLASTPTFSRGG-PVPIRPIVSRITIHWPSFYNRRDWENPGVT 483 CT + R + G S+ T S P+ ++ RRDWENPGVT Sbjct: 5 CTLKYWRSRKPGNTNSSTTASSAVIGDPLESTCRHASLALAVVLQRRDWENPGVT 59 >SB_8880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 10/57 (17%) Frame = +1 Query: 343 MAELGCLASTPTFSRGGPVPIRPIVSRITIH---WPSFYN-------RRDWENPGVT 483 ++ + L S GG R + + + + S+YN RRDWENPGVT Sbjct: 49 LSPVAILISIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVT 105 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 10/60 (16%) Frame = +1 Query: 334 HLRMAELGCLASTPTFSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 H+ + C +S + S G P+ + R + + P S+YN RRDWENPGVT Sbjct: 19 HIIKSRCSCQSSN-SCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 77 >SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 10/45 (22%) Frame = +1 Query: 379 FSRGGPVPIRPIVSRITIHWP---SFYN-------RRDWENPGVT 483 FS G P+ + R + + P S+YN RRDWENPGVT Sbjct: 48 FSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 92 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 41 RRDWENPGVT 50 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 21 RRDWENPGVT 30 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 68 RRDWENPGVT 77 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 50 RRDWENPGVT 59 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 42 RRDWENPGVT 51 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 68 RRDWENPGVT 77 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 73 RRDWENPGVT 82 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 44 RRDWENPGVT 53 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 64 RRDWENPGVT 73 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 76 RRDWENPGVT 85 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 52 RRDWENPGVT 61 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 41 RRDWENPGVT 50 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 31 RRDWENPGVT 40 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 56 RRDWENPGVT 65 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 65 RRDWENPGVT 74 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 59 RRDWENPGVT 68 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 75 RRDWENPGVT 84 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 63 RRDWENPGVT 72 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 46 RRDWENPGVT 55 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 222 RRDWENPGVT 231 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 117 RRDWENPGVT 126 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 55 RRDWENPGVT 64 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 34 RRDWENPGVT 43 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 22 RRDWENPGVT 31 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 53 RRDWENPGVT 62 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 387 RRDWENPGVT 396 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 113 RRDWENPGVT 122 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 89 RRDWENPGVT 98 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 45 RRDWENPGVT 54 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 14 RRDWENPGVT 23 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 24 RRDWENPGVT 33 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 44 RRDWENPGVT 53 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 109 RRDWENPGVT 118 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 51 RRDWENPGVT 60 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 346 RRDWENPGVT 355 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 86 RRDWENPGVT 95 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 56 RRDWENPGVT 65 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 22 RRDWENPGVT 31 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 65 RRDWENPGVT 74 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 140 RRDWENPGVT 149 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 69 RRDWENPGVT 78 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 45 RRDWENPGVT 54 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 149 RRDWENPGVT 158 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 839 RRDWENPGVT 848 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 22 RRDWENPGVT 31 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 66 RRDWENPGVT 75 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 40 RRDWENPGVT 49 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 79 RRDWENPGVT 88 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 73 RRDWENPGVT 82 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 62 RRDWENPGVT 71 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 75 RRDWENPGVT 84 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 262 RRDWENPGVT 271 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 120 RRDWENPGVT 129 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 56 RRDWENPGVT 65 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 42 RRDWENPGVT 51 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 43 RRDWENPGVT 52 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 107 RRDWENPGVT 116 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 120 RRDWENPGVT 129 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 45 RRDWENPGVT 54 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 64 RRDWENPGVT 73 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 43 RRDWENPGVT 52 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 40 RRDWENPGVT 49 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 17 RRDWENPGVT 26 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 25 RRDWENPGVT 34 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 402 RRDWENPGVT 411 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 51 RRDWENPGVT 60 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 60 RRDWENPGVT 69 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 42 RRDWENPGVT 51 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 125 RRDWENPGVT 134 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 61 RRDWENPGVT 70 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 71 RRDWENPGVT 80 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 74 RRDWENPGVT 83 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 420 RRDWENPGVT 429 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 117 RRDWENPGVT 126 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 62 RRDWENPGVT 71 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 52 RRDWENPGVT 61 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 55 RRDWENPGVT 64 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 167 RRDWENPGVT 176 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 71 RRDWENPGVT 80 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 58 RRDWENPGVT 67 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 94 RRDWENPGVT 103 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 43 RRDWENPGVT 52 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 69 RRDWENPGVT 78 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 48 RRDWENPGVT 57 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 191 RRDWENPGVT 200 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 40 RRDWENPGVT 49 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 46 RRDWENPGVT 55 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 60 RRDWENPGVT 69 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 57 RRDWENPGVT 66 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 40 RRDWENPGVT 49 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 41 RRDWENPGVT 50 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 55 RRDWENPGVT 64 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 45 RRDWENPGVT 54 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 138 RRDWENPGVT 147 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 47 RRDWENPGVT 56 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 90 RRDWENPGVT 99 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 28 RRDWENPGVT 37 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 35 RRDWENPGVT 44 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 159 RRDWENPGVT 168 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 346 RRDWENPGVT 355 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 63 RRDWENPGVT 72 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 454 RRDWENPGVT 483 RRDWENPGVT Sbjct: 27 RRDWENPGVT 36 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,951,382 Number of Sequences: 59808 Number of extensions: 368327 Number of successful extensions: 3928 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3908 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -