BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0023 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.2 DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. 24 2.8 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 6.4 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 115 SWSLLFLFVESEERHV--GYFYHLKTNSGNVTDGVTF 219 S+ + F + +++ +V G+F+HL+ N G + TF Sbjct: 901 SYRMYFSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937 >DQ182016-1|ABA56308.1| 353|Anopheles gambiae G(alpha)i protein. Length = 353 Score = 24.2 bits (50), Expect = 2.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 207 RRDLYDRIPPLVLRRFFDVV*ATVTGDECGHFLSVLNELYTD 332 R D D + R+FF AT G+ +S++ +L+TD Sbjct: 91 RIDFADPSKTDIARQFFTYASATEEGELTPELVSLMKKLWTD 132 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 6.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 341 RKCVRVQLIKNGKKVT 294 RKCVR L K+G ++T Sbjct: 330 RKCVRSTLAKHGNEMT 345 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,210 Number of Sequences: 2352 Number of extensions: 11169 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -