BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0023 (531 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical pr... 89 1e-18 Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical pr... 30 1.2 AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical ... 28 4.8 AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical ... 28 4.8 >Z70684-7|CAA94601.1| 143|Caenorhabditis elegans Hypothetical protein F28D1.7 protein. Length = 143 Score = 89.4 bits (212), Expect = 1e-18 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = -2 Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252 G LEK+GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN +E+ Sbjct: 49 GIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFVEE 96 Score = 89.0 bits (211), Expect = 2e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -1 Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112 +NDEVLV+GFGR GHAVGDIPGVRFK+VKVAN SL+AL+K KKERPRS Sbjct: 96 ENDEVLVSGFGRSGHAVGDIPGVRFKIVKVANTSLIALFKGKKERPRS 143 >Z92838-1|CAB07406.1| 157|Caenorhabditis elegans Hypothetical protein T03D8.2 protein. Length = 157 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -2 Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273 G L+ V K+PNS RKC V+L G +V A++P G Sbjct: 78 GIVLKTVIRHPKKPNSGNRKCAIVRL-STGAEVCAYIPNVG 117 >AL132898-6|CAC14409.1| 187|Caenorhabditis elegans Hypothetical protein Y59A8B.9 protein. Length = 187 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 176 TLKRTPGMSPTA*PLRPNPATSTSS 250 T RTP +P A P RP P+ S+++ Sbjct: 38 TTMRTPAATPAAPPTRPTPSRSSAA 62 >AL132898-5|CAC14408.1| 316|Caenorhabditis elegans Hypothetical protein Y59A8B.7 protein. Length = 316 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 176 TLKRTPGMSPTA*PLRPNPATSTSS 250 T RTP +P A P RP P+ S+++ Sbjct: 167 TTMRTPAATPAAPPTRPTPSRSSAA 191 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,209,551 Number of Sequences: 27780 Number of extensions: 258254 Number of successful extensions: 601 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -