BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0021 (393 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 21 5.1 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 5.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 5.1 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 5.1 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.0 bits (42), Expect = 5.1 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -3 Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185 T+FL I+ ++ NA + + K + + WF LD I Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 5.1 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -3 Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185 T+FL I+ ++ NA + + K + + WF LD I Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 5.1 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -3 Query: 319 TVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSI 185 T+FL I+ ++ NA + + K + + WF LD I Sbjct: 130 TIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLI 174 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 5.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 Query: 188 DKTSATILRCDG 153 DKT TILR DG Sbjct: 75 DKTFVTILRYDG 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,971 Number of Sequences: 438 Number of extensions: 1512 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -