BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0017 (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF... 27 1.9 SPBC18A7.02c |||seven transmembrane receptor-like protein|Schizo... 27 1.9 >SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF3c|Schizosaccharomyces pombe|chr 1|||Manual Length = 918 Score = 26.6 bits (56), Expect = 1.9 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +3 Query: 84 FHENIRVNLLKCCYVSCYSFSLQLTQVFQSSSFSYNTK 197 FH +I + LL+C Y++C S +++ + +SS + +++ Sbjct: 681 FHMHINLELLECVYLTC-SMLMEIPAMAAASSTASDSR 717 >SPBC18A7.02c |||seven transmembrane receptor-like protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 457 Score = 26.6 bits (56), Expect = 1.9 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 345 LLIVFWSQCRGVEAHRNSTKMSYVCPPSFIRLGHSC 452 +LI W + R + A R+ + +Y+C + H C Sbjct: 64 VLIFNWKEIRKLGAFRSDDQFTYICDYDAVYTDHLC 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,865,585 Number of Sequences: 5004 Number of extensions: 35327 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -