BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0017 (477 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1137 - 26392399-26392613,26392828-26393233 29 2.6 07_03_0983 + 23124866-23125075,23125846-23125932,23126039-231262... 27 5.9 >12_02_1137 - 26392399-26392613,26392828-26393233 Length = 206 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 54 TNNQISNGFLFHENIRVNLLKCCYVSCYSFSLQ 152 +N+ +S+G+ F ++ V L +CC + CY Q Sbjct: 44 SNSGVSHGWTFVSDLEV-LTRCCMIDCYGGDAQ 75 >07_03_0983 + 23124866-23125075,23125846-23125932,23126039-23126290, 23126399-23126563,23126897-23126950,23127106-23127252, 23127814-23128191 Length = 430 Score = 27.5 bits (58), Expect = 5.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 286 VNVEIWQIPREDNWLLQ 336 +N+ +W+ P+E NW LQ Sbjct: 299 INILVWKDPKEGNWWLQ 315 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,684,663 Number of Sequences: 37544 Number of extensions: 216237 Number of successful extensions: 470 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 979080328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -