BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0017 (477 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_52231| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 7.9 >SB_54052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 469 SLKENKQLCPSRIKEGGHTYDIFVLFLCASTP 374 SL++ LC + I+ GG T+ + LCA++P Sbjct: 27 SLRKENVLCDAVIQIGGKTHPVHKNVLCAASP 58 >SB_52231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 432 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 429 KKADTRTTSLCYFYAPPRLGIETRRQS 349 KK+ TR+ CY + PP +G T QS Sbjct: 255 KKSTTRSVFQCYVFGPPGVGKTTFLQS 281 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 475 SVSLKENKQLCPSRIKEGGHTYDIFVLFLCASTPRH 368 S S+ +++C S+ GG D++V+ A TPRH Sbjct: 1021 SYSVYNRREVC-SQGMGGGWANDVYVILRRAGTPRH 1055 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,933,877 Number of Sequences: 59808 Number of extensions: 262235 Number of successful extensions: 499 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -