BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0016 (532 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.9 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.6 bits (41), Expect = 8.9 Identities = 12/62 (19%), Positives = 26/62 (41%) Frame = +1 Query: 322 EQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLLQRREMFCSD 501 E+ + + + N+F +++H + ++R F+G I + L + F S Sbjct: 45 EELDLSNNRLRNVPDNSFHFLRSLKKVHLQDNTIEMIHRGTFQGDIHRDLTEVYFSFNSV 104 Query: 502 EN 507 N Sbjct: 105 RN 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,914 Number of Sequences: 336 Number of extensions: 3024 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -