BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0016 (532 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119495-1|AAM50149.1| 432|Drosophila melanogaster GH10162p pro... 38 0.011 AE013599-3106|AAF46655.1| 432|Drosophila melanogaster CG3295-PA... 38 0.011 AF160938-1|AAD46878.1| 845|Drosophila melanogaster BcDNA.LD1876... 35 0.079 AE014134-1943|AAF53002.1| 845|Drosophila melanogaster CG6743-PA... 35 0.079 EF057988-1|ABL84923.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057987-1|ABL84922.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057986-1|ABL84921.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057985-1|ABL84920.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057984-1|ABL84919.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057983-1|ABL84918.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057982-1|ABL84917.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057981-1|ABL84916.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057979-1|ABL84914.1| 846|Drosophila melanogaster Nup107 protein. 33 0.18 EF057978-1|ABL84913.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057977-1|ABL84912.1| 845|Drosophila melanogaster Nup107 protein. 33 0.18 EF057980-1|ABL84915.1| 845|Drosophila melanogaster Nup107 protein. 31 0.74 BT023819-1|AAZ86740.1| 741|Drosophila melanogaster SD06601p pro... 29 5.2 AJ606680-1|CAE54809.1| 741|Drosophila melanogaster lamin B rece... 29 5.2 AY060601-1|AAL28149.1| 470|Drosophila melanogaster GH01839p pro... 28 6.9 AE013599-570|AAF59148.2| 470|Drosophila melanogaster CG14762-PA... 28 6.9 >AY119495-1|AAM50149.1| 432|Drosophila melanogaster GH10162p protein. Length = 432 Score = 37.5 bits (83), Expect = 0.011 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +1 Query: 301 PNTP--LTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLL 474 P P LT Q + V + + +LST+HR+LH ++SK G+ F + Sbjct: 81 PTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM- 139 Query: 475 QRREMFCSDENHLLWNKPL 531 R ++ +EN +L NK + Sbjct: 140 -RVDVLQDEENLMLLNKAI 157 >AE013599-3106|AAF46655.1| 432|Drosophila melanogaster CG3295-PA protein. Length = 432 Score = 37.5 bits (83), Expect = 0.011 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%) Frame = +1 Query: 301 PNTP--LTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLL 474 P P LT Q + V + + +LST+HR+LH ++SK G+ F + Sbjct: 81 PTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM- 139 Query: 475 QRREMFCSDENHLLWNKPL 531 R ++ +EN +L NK + Sbjct: 140 -RVDVLQDEENLMLLNKAI 157 >AF160938-1|AAD46878.1| 845|Drosophila melanogaster BcDNA.LD18761 protein. Length = 845 Score = 34.7 bits (76), Expect = 0.079 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QLS DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLSWDHRLL 764 >AE014134-1943|AAF53002.1| 845|Drosophila melanogaster CG6743-PA protein. Length = 845 Score = 34.7 bits (76), Expect = 0.079 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QLS DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLSWDHRLL 764 >EF057988-1|ABL84923.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057987-1|ABL84922.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057986-1|ABL84921.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057985-1|ABL84920.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057984-1|ABL84919.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057983-1|ABL84918.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057982-1|ABL84917.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057981-1|ABL84916.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057979-1|ABL84914.1| 846|Drosophila melanogaster Nup107 protein. Length = 846 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 709 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 765 >EF057978-1|ABL84913.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057977-1|ABL84912.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV+E ++ + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >EF057980-1|ABL84915.1| 845|Drosophila melanogaster Nup107 protein. Length = 845 Score = 31.5 bits (68), Expect = 0.74 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = +1 Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402 +R + R+ +KV E + + N + P++ +V + + +NA QL+ DHR L Sbjct: 708 HRSEVVRWEHKVXEQXXQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 764 >BT023819-1|AAZ86740.1| 741|Drosophila melanogaster SD06601p protein. Length = 741 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 312 WCIWWLLGYFPPQLLYFVNISCNTSSVCSFKFVNFVIAL 196 W +LL P +Y++ SC + C FK +N I L Sbjct: 311 WLGAFLLLLLLPTAVYYLTWSCTARNACQFKHLNLGILL 349 >AJ606680-1|CAE54809.1| 741|Drosophila melanogaster lamin B receptor protein. Length = 741 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 312 WCIWWLLGYFPPQLLYFVNISCNTSSVCSFKFVNFVIAL 196 W +LL P +Y++ SC + C FK +N I L Sbjct: 311 WLGAFLLLLLLPTAVYYLTWSCTARNACQFKHLNLGILL 349 >AY060601-1|AAL28149.1| 470|Drosophila melanogaster GH01839p protein. Length = 470 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 286 IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKS 423 + Q PP T + PEQ++ ++ T+K+N + + +L A ++KS Sbjct: 29 LGQGPPQTQVCPEQSE-IAPCICTVKKNGLDILCETTDL-AHITKS 72 >AE013599-570|AAF59148.2| 470|Drosophila melanogaster CG14762-PA protein. Length = 470 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 286 IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKS 423 + Q PP T + PEQ++ ++ T+K+N + + +L A ++KS Sbjct: 29 LGQGPPQTQVCPEQSE-IAPCICTVKKNGLDILCETTDL-AHITKS 72 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,377,691 Number of Sequences: 53049 Number of extensions: 502516 Number of successful extensions: 1163 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1991467008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -