BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0013 (573 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 24 0.80 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 5.6 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 7.5 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 24.2 bits (50), Expect = 0.80 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 327 GWQSWAA*LLHQLSRGGARYPIRPIVSRITIHWPS 431 GW W+ +++L+R A + +R T++W S Sbjct: 569 GWFFWSLLRIYELARKAAFAHLNSNEARATLNWVS 603 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -3 Query: 202 GHAVGDIPGVR 170 G AVGD+PG+R Sbjct: 62 GTAVGDVPGLR 72 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 517 YYAAAKGECACKAIKLGNARVFPV 446 Y+A G+ ACK + G + FPV Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 517 YYAAAKGECACKAIKLGNARVFPV 446 Y+A G+ ACK + G + FPV Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 517 YYAAAKGECACKAIKLGNARVFPV 446 Y+A G+ ACK + G + FPV Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 517 YYAAAKGECACKAIKLGNARVFPV 446 Y+A G+ ACK + G + FPV Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +1 Query: 88 CTPMILVAPFSLCRERGET 144 C P + V P C E G T Sbjct: 163 CDPAVCVLPDCFCSEDGTT 181 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -2 Query: 341 PTLPSANASVYSSLRTERK*PHSSPVTVAKPH 246 P ++Y+S + +R P SP++ P+ Sbjct: 457 PPSTELGTNIYTSSKRQRTSPQLSPMSSLPPY 488 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,655 Number of Sequences: 336 Number of extensions: 3219 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -