BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0013 (573 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 103 1e-22 SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 83 2e-16 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 74 7e-14 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 7e-14 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 72 4e-13 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 5e-12 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 67 8e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 8e-12 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 3e-11 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 65 3e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 64 6e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 64 6e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 64 6e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 64 1e-10 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 64 1e-10 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 64 1e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 64 1e-10 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 64 1e-10 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 64 1e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 64 1e-10 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 64 1e-10 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 64 1e-10 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 64 1e-10 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 64 1e-10 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 64 1e-10 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 64 1e-10 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 64 1e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 63 2e-10 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 61 5e-10 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 5e-10 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 60 1e-09 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 60 1e-09 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 60 1e-09 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 60 1e-09 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 60 1e-09 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 60 1e-09 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 60 1e-09 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 60 1e-09 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 60 1e-09 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 60 1e-09 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 60 1e-09 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 60 1e-09 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 60 1e-09 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 60 1e-09 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 60 1e-09 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 60 1e-09 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 60 1e-09 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 60 1e-09 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 60 1e-09 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 60 1e-09 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 60 1e-09 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 60 1e-09 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 60 1e-09 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 60 1e-09 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 60 1e-09 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 60 1e-09 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 60 1e-09 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 60 1e-09 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 60 1e-09 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 60 1e-09 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 60 1e-09 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 60 1e-09 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 60 1e-09 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 60 1e-09 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 60 1e-09 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 60 1e-09 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 60 1e-09 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 60 1e-09 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 60 1e-09 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 60 1e-09 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 60 1e-09 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 60 1e-09 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 60 1e-09 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 60 1e-09 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 60 1e-09 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 60 1e-09 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 60 1e-09 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 60 1e-09 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 60 1e-09 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 60 1e-09 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 60 1e-09 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 60 1e-09 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 60 1e-09 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 60 1e-09 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 60 1e-09 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 60 1e-09 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 60 1e-09 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 60 1e-09 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 60 1e-09 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 60 1e-09 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 60 1e-09 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 60 1e-09 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 60 1e-09 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 60 1e-09 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 60 1e-09 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 60 1e-09 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 60 1e-09 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 60 2e-09 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 59 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 58 4e-09 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 58 4e-09 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 58 4e-09 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 58 5e-09 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 57 9e-09 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 57 9e-09 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 9e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 57 1e-08 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 57 1e-08 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 57 1e-08 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 57 1e-08 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 57 1e-08 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 57 1e-08 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 57 1e-08 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 57 1e-08 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 57 1e-08 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 57 1e-08 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 57 1e-08 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 57 1e-08 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 57 1e-08 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 57 1e-08 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 57 1e-08 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 57 1e-08 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 57 1e-08 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 103 bits (247), Expect = 1e-22 Identities = 47/52 (90%), Positives = 52/52 (100%) Frame = -3 Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98 N+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 92 NYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 Score = 75.4 bits (177), Expect = 3e-14 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 369 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256 ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 82.6 bits (195), Expect = 2e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256 G LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC Sbjct: 48 GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 89 Score = 56.4 bits (130), Expect = 2e-08 Identities = 22/27 (81%), Positives = 27/27 (100%) Frame = -3 Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGV 173 N+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 91 NYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/53 (71%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 AIGAG + E+G LQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 50 AIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 76.2 bits (179), Expect = 2e-14 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = -1 Query: 561 ANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 A LL +GDRCG RKG+VL RRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 AQLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 74.1 bits (174), Expect = 7e-14 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 AIGAG + ERGMC + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 74.1 bits (174), Expect = 7e-14 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 AIGAG + ERGMC + +G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 16 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 72.1 bits (169), Expect = 3e-13 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 503 ERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 ERGMC + +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 21 ERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 35.1 bits (77), Expect = 0.041 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = -3 Query: 553 VGKGRSVRGLFGYYAAAKGECACKAIKLGNARVFP 449 VGKG GLF A + CKAIKLGNA+ FP Sbjct: 5 VGKGDRC-GLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 71.7 bits (168), Expect = 4e-13 Identities = 33/52 (63%), Positives = 36/52 (69%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 AIGAG + ERGMC + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 10 AIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 70.1 bits (164), Expect = 1e-12 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = -1 Query: 549 ERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ++GDRCG RKG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 66 QQGDRCGPLRYYASWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 69.3 bits (162), Expect = 2e-12 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = -1 Query: 546 RGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 +GDRCG RKG+VL RLSWVTPGFSQSRRCKTTASEL Sbjct: 7 KGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 68.1 bits (159), Expect = 5e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 390 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQ 488 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQ 65 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 67.7 bits (158), Expect = 6e-12 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -2 Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 CW+G LLR+ +G C GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 26 CWEGR-SVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 67.3 bits (157), Expect = 8e-12 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRAN 390 +IGAG + ERGMC + +G +GFPSHD KRRPVNCNTTHYRAN Sbjct: 47 SIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 67.3 bits (157), Expect = 8e-12 Identities = 33/52 (63%), Positives = 36/52 (69%) Frame = -2 Query: 542 AIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 AIGAG + ERGMC + + FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1849 AIGAGLFAITPAGERGMCCKAIKLV-TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 396 PIVSRITIHWPSFYNVVTGKTLALPNLIALQ 488 P +SRITIHWPSFYNVVTGKTLALPNLIALQ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQ 107 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQAH 494 SRITIHWPSFYNVVTGKTLALPNLIALQ H Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLH 31 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 65.3 bits (152), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQAH 494 SRITIHWPSFYNVVTGKTLALPNLIAL AH Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAH 31 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 65.3 bits (152), Expect = 3e-11 Identities = 42/93 (45%), Positives = 51/93 (54%), Gaps = 6/93 (6%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASE----L*YDSL*GELGTGPPLEKV 361 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS L DS L GP K+ Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLRWGPHASKI 94 Query: 360 GVEAKQPNSAIRKCVR--VQLIKNGKKVTAFVP 268 +A + +R+ ++ QL+K T P Sbjct: 95 SDKANKVLGLLRRTLKPCSQLVKERAYFTLVRP 127 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 64.5 bits (150), Expect = 6e-11 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -2 Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 CW+G LLR+ +G C GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 597 CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 64.5 bits (150), Expect = 6e-11 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -2 Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 CW+G LLR+ +G C GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 40 CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 64.5 bits (150), Expect = 6e-11 Identities = 32/56 (57%), Positives = 35/56 (62%) Frame = -2 Query: 554 CWKGAIGAGPLRLLRRCERGMCLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 387 CW+G LLR+ +G C GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 40 CWEGR-SVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNTTHYRANW 91 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 64.1 bits (149), Expect = 8e-11 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -1 Query: 552 LERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 L G ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 LWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 232 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 900 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 387 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 236 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 303 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 369 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 61 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 464 RQGFPSHDVVKRRPVNCNTTHYRANW 387 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 43 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 279 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 263 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 252 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 277 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 461 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 130 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 296 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 146 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 205 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 597 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 233 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 511 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 94 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 402 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 ASS + L KG ARRLSWVTPGFSQSRRCKTTASEL Sbjct: 195 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488 SRITIHWPSFYNVVTGKTLALPNLIALQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQ 29 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 62.9 bits (146), Expect = 2e-10 Identities = 31/43 (72%), Positives = 32/43 (74%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL*YDSL 400 ASS + L KG ARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 20 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 56.8 bits (131), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529 LAVVLQRRDWENPGVTQLNRLA+ PF S +EEA Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 120 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488 SRITIHWPSFYNVVTGKTLALPNLIALQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQ 29 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 62.9 bits (146), Expect = 2e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 405 SRITIHWPSFYNVVTGKTLALPNLIALQ 488 SRITIHWPSFYNVVTGKTLALPNLIALQ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQ 29 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.5 bits (145), Expect = 2e-10 Identities = 33/47 (70%), Positives = 34/47 (72%) Frame = -1 Query: 561 ANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 A LLE G ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 17 AQLLE-GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.5 bits (145), Expect = 2e-10 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 3/52 (5%) Frame = -1 Query: 567 AGANLLER---GDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 AG N+L G ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 46 AGKNMLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 62.1 bits (144), Expect = 3e-10 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASE 418 ASS + L KG ARRLSWVTPGFSQSRRCKTTASE Sbjct: 542 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 62.1 bits (144), Expect = 3e-10 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -1 Query: 564 GANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 G + +GDRCG RKG+ A RLS TPGFSQSRRCKTTASEL Sbjct: 30 GCATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 4e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 458 GFPSHDVVKRRPVNCNTTHYRANW 387 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 61.3 bits (142), Expect = 5e-10 Identities = 32/51 (62%), Positives = 33/51 (64%) Frame = -1 Query: 573 FQAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 F A L G ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 61.3 bits (142), Expect = 5e-10 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = +3 Query: 372 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIALQAH 494 GGA PIRPIVSRITIHWP+FYN TGKTLA L L AH Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAH 74 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 61.3 bits (142), Expect = 5e-10 Identities = 32/51 (62%), Positives = 33/51 (64%) Frame = -1 Query: 573 FQAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 F A L G ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/46 (67%), Positives = 32/46 (69%) Frame = -1 Query: 552 LERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTASEL 415 L G ASS + L KG ARRLSWVTP FSQSRRCKTTASEL Sbjct: 4 LWEGRSVRASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 60.5 bits (140), Expect = 1e-09 Identities = 33/50 (66%), Positives = 34/50 (68%) Frame = -1 Query: 570 QAGANLLERGDRCGASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 QA N E G ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 405 QALRNCWE-GRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 488 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 158 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 235 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 379 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 81 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 662 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 571 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 45 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 801 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 462 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 81 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 383 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 1117 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 308 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 122 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 32 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 48 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 498 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 106 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 66 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 68 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 167 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 27 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 204 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 140 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 111 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 67 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 13 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 60.1 bits (139), Expect = 1e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 528 ASSAITPLRKGNVLARRLSWVTPGFSQSRRCKTTAS 421 ASS + L KG ARRLSWVTPGFSQSRRCKTTAS Sbjct: 35 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,608,950 Number of Sequences: 59808 Number of extensions: 446227 Number of successful extensions: 4592 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4551 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -