BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0012 (588 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) 114 6e-26 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 52 3e-07 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 6e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 51 6e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 51 6e-07 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 51 8e-07 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 50 2e-06 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 49 3e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 49 3e-06 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 7e-05 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 44 9e-05 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 42 4e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 40 0.002 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 40 0.002 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 40 0.002 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 40 0.002 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 40 0.002 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 40 0.002 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 40 0.002 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 40 0.002 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 40 0.002 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 40 0.002 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 40 0.002 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 40 0.002 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 40 0.002 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 40 0.002 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 39 0.003 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 39 0.003 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 39 0.003 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 39 0.003 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 39 0.003 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 39 0.003 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 39 0.003 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 39 0.003 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 39 0.003 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 39 0.003 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 39 0.003 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 39 0.003 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 39 0.003 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 39 0.003 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 39 0.003 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 39 0.003 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 39 0.003 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 39 0.003 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 39 0.003 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 39 0.003 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 39 0.003 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 39 0.003 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 39 0.003 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 39 0.003 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 39 0.003 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 39 0.003 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 39 0.003 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 39 0.003 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 39 0.003 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 39 0.003 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 39 0.003 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 39 0.003 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 39 0.003 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 39 0.003 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 39 0.003 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 39 0.003 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 39 0.003 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 39 0.003 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 39 0.003 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 39 0.003 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 39 0.003 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 39 0.003 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 39 0.003 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 39 0.003 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 39 0.003 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 39 0.003 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 39 0.003 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 39 0.003 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 39 0.003 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 39 0.003 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 39 0.003 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 39 0.003 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 39 0.003 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 39 0.003 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 39 0.003 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 39 0.003 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 39 0.003 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 39 0.003 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 39 0.003 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 39 0.003 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 39 0.003 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 39 0.003 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 39 0.003 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 39 0.003 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 >SB_13936| Best HMM Match : ABC_tran (HMM E-Value=4.6e-14) Length = 441 Score = 114 bits (274), Expect = 6e-26 Identities = 50/73 (68%), Positives = 60/73 (82%) Frame = +2 Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415 V G P S+D+KI NFSITF+G ELL D LELN GR+YGL+GLNGCGKS++L A+ +RE Sbjct: 46 VLGSHPMSKDVKIDNFSITFHGVELLTDAKLELNTGRKYGLIGLNGCGKSTMLTAIGKRE 105 Query: 416 VPIPEHIDIFHLT 454 +PIPEH DIFHLT Sbjct: 106 IPIPEHFDIFHLT 118 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 62.5 bits (145), Expect = 2e-10 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = -3 Query: 586 RGNVLQGN*-VGERQGFPSHNVCKTTAVNCNTTHYRANW 473 +G+VLQG+ +G+RQGFPSH+V K VNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 59.7 bits (138), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 476 IRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583 +RP+VSRITIH F NVVTGKTLA PNLIALQ IP Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 >SB_27093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 59.3 bits (137), Expect = 2e-09 Identities = 28/65 (43%), Positives = 42/65 (64%) Frame = +2 Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436 S+DI+I NF + + LL+ L + GRRYGLVG NG GK++LL L +RE+ + +I Sbjct: 204 SQDIRIENFDLAYGNRSLLKGANLAIAFGRRYGLVGRNGIGKTTLLRTLSKRELFVASNI 263 Query: 437 DIFHL 451 I ++ Sbjct: 264 SILYV 268 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586 SRITIH F NVVTGKTLA PNLIALQ IPP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPP 33 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +2 Query: 482 PIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583 P +SRITIH F NVVTGKTLA PNLIALQ IP Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = -3 Query: 550 RQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 R GFPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 93 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 52.8 bits (121), Expect = 2e-07 Identities = 22/38 (57%), Positives = 26/38 (68%) Frame = -3 Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANW 473 RG + +G +GFPSH+V K VNCNTTHYRANW Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/47 (51%), Positives = 30/47 (63%) Frame = -3 Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVNVFRNRNLTAS 404 GFPSH+V K VNCNTTHYRANW ++ +E V+ RN +S Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSISS 671 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQR 525 KG C AR+LSWG P +R Sbjct: 614 KGGCAARRLSWGFPSHDVVKR 634 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 51.6 bits (118), Expect = 5e-07 Identities = 24/46 (52%), Positives = 29/46 (63%) Frame = -3 Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVNVFRNRNLTA 407 GFPSH+V K VNCNTTHYRANW ++ +E V+ RN A Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSIA 102 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -2 Query: 587 KGECPARQLSWGTPGF 540 KG C AR+LSW TPGF Sbjct: 43 KGGCAARRLSWVTPGF 58 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -3 Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 GFPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 37 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -3 Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 GFPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 104 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQR 525 KG C AR+LSWG P +R Sbjct: 57 KGGCAARRLSWGFPSHDVVKR 77 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 51.2 bits (117), Expect = 6e-07 Identities = 21/37 (56%), Positives = 26/37 (70%) Frame = -3 Query: 544 GFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 GFPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 104 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQR 525 KG C AR+LSWG P +R Sbjct: 57 KGGCAARRLSWGFPSHDVVKR 77 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583 SRITIH F NVVTGKTLA PNLIALQ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583 SRITIH F NVVTGKTLA PNLIALQ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/51 (45%), Positives = 30/51 (58%) Frame = -3 Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 RG + +G FPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 30 RGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 80 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/45 (62%), Positives = 29/45 (64%) Frame = +2 Query: 452 TRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586 T GGA PIRPIVSRITIH F N TGKTLA+ L L PP Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPP 76 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586 SRITIH F NVVTGKTLA PNLIALQ PP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPP 33 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 48.8 bits (111), Expect = 3e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -3 Query: 541 FPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 FPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 74 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 582 GMSCKAIKLGNARVFPVTTFVKRRP 508 GM CK+IKL +A VFP VKRRP Sbjct: 25 GMCCKSIKLAHASVFPSHDVVKRRP 49 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 48.8 bits (111), Expect = 3e-06 Identities = 20/36 (55%), Positives = 25/36 (69%) Frame = -3 Query: 541 FPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 FPSH+V K VNCNTTHYRANW ++ +E V+ Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 72 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 48.8 bits (111), Expect = 3e-06 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -3 Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANW 473 RG + +G FPSH+V K VNCNTTHYRANW Sbjct: 16 RGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIPP 586 SRITIH F NVVTGKTLA PNLIAL PP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPP 33 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -3 Query: 541 FPSHNVCKTTAVNCNTTHYRANW 473 FPSH+V K VNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 582 GMSCKAIKLGNARVFPVTTFVKRRP 508 GM CKAIKL VFP VKRRP Sbjct: 1864 GMCCKAIKLVTP-VFPSHDVVKRRP 1887 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = +2 Query: 509 GRRFTNVVTGKTLAFPNLIALQDIP 583 GRRFT +VTGKTLA PNLIALQ IP Sbjct: 56 GRRFTTLVTGKTLALPNLIALQHIP 80 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 45.6 bits (103), Expect = 3e-05 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = +1 Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588 FYKR DWENPGV QLN LA H PF Sbjct: 32 FYKRRDWENPGVNQLNRLAAHPPF 55 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +2 Query: 491 SRITIHGRRFTNVVTGKTLAFPNLIALQDIP 583 SRITIH F NVVTGKTLA PNL L+ IP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIP 32 >SB_30085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 44.4 bits (100), Expect = 7e-05 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +2 Query: 251 PCSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424 P ++K N S+ +Y G ++L + +++ G R G+ G G GKSSL+AAL R +P Sbjct: 227 PAHGNVKFENVSLRYYEGGPQVLHNLNIDIKGGERVGVAGRTGAGKSSLVAALFR--MPD 284 Query: 425 PE 430 PE Sbjct: 285 PE 286 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = -3 Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRAN 476 RG + +G +GFPSH+ K VNCNTTHYRAN Sbjct: 61 RGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 44.0 bits (99), Expect = 9e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 582 GMSCKAIKLGNARVFPVTTF 523 GM CKAIKLGNARVFPVTTF Sbjct: 38 GMCCKAIKLGNARVFPVTTF 57 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 532 HNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 H+V K VNCNTTHYRANW ++ +E V+ Sbjct: 2 HDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 34 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -3 Query: 532 HNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 H+V K VNCNTTHYRANW ++ +E V+ Sbjct: 2 HDVVKRRPVNCNTTHYRANWSSTAVAAALELVD 34 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583 H F NVVTGKTLA PNLIALQ IP Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIP 87 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583 H F NVVTGKTLA PNLIALQ IP Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIP 30 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = +2 Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583 H F NVVTGKTLA PNLIALQ IP Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIP 82 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 41.5 bits (93), Expect = 5e-04 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +2 Query: 266 IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430 + + N S+ +Y E+L+D +N R G+ G G GKSSL++AL R +P PE Sbjct: 1010 VDLVNVSLAYYPGAPEVLKDVTFSINPAERVGIAGRTGAGKSSLVSALFR--MPDPE 1064 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -1 Query: 579 MSCKAIKLGNARVFPVTTFVKRRP 508 M CKAIKLGNARVFP VKRRP Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRP 24 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588 F +R DWENPGV QLN LA H PF Sbjct: 68 FLQRRDWENPGVTQLNRLAAHPPF 91 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588 F +R DWENPGV QLN LA H PF Sbjct: 11 FLQRRDWENPGVTQLNRLAAHPPF 34 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 41.1 bits (92), Expect = 7e-04 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = -3 Query: 586 RGNVLQGN*VGERQGFPSHNVCKTTAVNCNTTHYRANWVPGPPSSQMEYVN 434 RG + +G F SH+V K VNCNTTHYRAN ++ +E V+ Sbjct: 4 RGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRANRSSTAVAAALELVD 54 >SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +1 Query: 517 FYKRCDWENPGVPQLNCLAGHSPF 588 F +R DWENPGV QLN L H PF Sbjct: 19 FLQRRDWENPGVTQLNLLGAHPPF 42 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 70 QRLDWENPGVTQLNRLAAHPPF 91 >SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN L GH PF Sbjct: 13 QRRDWENPGVTQLNRLGGHPPF 34 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 70 QRLDWENPGVTQLNRLAAHPPF 91 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +1 Query: 520 YKRCDWENPGVPQLNCLAGHSPF 588 + R DWENPGV QLN LA H PF Sbjct: 44 FTRRDWENPGVTQLNRLAAHPPF 66 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 241 KGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 909 KGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 21 KGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 396 KGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 245 KGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 312 KGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 378 KGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 70 KGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 52 KGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 288 KGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 272 KGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 22 KGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +1 Query: 439 HIPSDSRGGPVXXXXXXXXXXXXXXXFYKRCDWENPGVPQLNCLAGHSPF 588 H+ S RG P+ +R DWENPGV QLN LA H PF Sbjct: 16 HLKSSLRGDPLESTCRHASLALAVVL--QRRDWENPGVTQLNRLAAHPPF 63 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 261 KGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 286 KGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 16 RRRDWENPGVTQLNRLAAHPPF 37 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 470 KGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 139 KGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 305 KGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 155 KGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 29 KGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 214 KGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 606 KGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 242 KGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 82 KGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 520 KGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 103 KGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 411 KGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = -2 Query: 587 KGECPARQLSWGTPGFSQSQRL*NDGREL 501 KG C AR+LSW TPGFSQS+R EL Sbjct: 204 KGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 40 QRRDWENPGVTQLNRLAAHPPF 61 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 20 QRRDWENPGVTQLNRLAAHPPF 41 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 67 QRRDWENPGVTQLNRLAAHPPF 88 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 49 QRRDWENPGVTQLNRLAAHPPF 70 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 41 QRRDWENPGVTQLNRLAAHPPF 62 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 67 QRRDWENPGVTQLNRLAAHPPF 88 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 72 QRRDWENPGVTQLNRLAAHPPF 93 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 43 QRRDWENPGVTQLNRLAAHPPF 64 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 63 QRRDWENPGVTQLNRLAAHPPF 84 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 75 QRRDWENPGVTQLNRLAAHPPF 96 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 51 QRRDWENPGVTQLNRLAAHPPF 72 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 40 QRRDWENPGVTQLNRLAAHPPF 61 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 30 QRRDWENPGVTQLNRLAAHPPF 51 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 55 QRRDWENPGVTQLNRLAAHPPF 76 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 64 QRRDWENPGVTQLNRLAAHPPF 85 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 58 QRRDWENPGVTQLNRLAAHPPF 79 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 74 QRRDWENPGVTQLNRLAAHPPF 95 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 62 QRRDWENPGVTQLNRLAAHPPF 83 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 45 QRRDWENPGVTQLNRLAAHPPF 66 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 221 QRRDWENPGVTQLNRLAAHPPF 242 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 116 QRRDWENPGVTQLNRLAAHPPF 137 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 54 QRRDWENPGVTQLNRLAAHPPF 75 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 33 QRRDWENPGVTQLNRLAAHPPF 54 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 21 QRRDWENPGVTQLNRLAAHPPF 42 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 52 QRRDWENPGVTQLNRLAAHPPF 73 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 386 QRRDWENPGVTQLNRLAAHPPF 407 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 112 QRRDWENPGVTQLNRLAAHPPF 133 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 88 QRRDWENPGVTQLNRLAAHPPF 109 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 44 QRRDWENPGVTQLNRLAAHPPF 65 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 13 QRRDWENPGVTQLNRLAAHPPF 34 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 23 QRRDWENPGVTQLNRLAAHPPF 44 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 43 QRRDWENPGVTQLNRLAAHPPF 64 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 108 QRRDWENPGVTQLNRLAAHPPF 129 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 50 QRRDWENPGVTQLNRLAAHPPF 71 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 345 QRRDWENPGVTQLNRLAAHPPF 366 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 85 QRRDWENPGVTQLNRLAAHPPF 106 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 55 QRRDWENPGVTQLNRLAAHPPF 76 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 21 QRRDWENPGVTQLNRLAAHPPF 42 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 64 QRRDWENPGVTQLNRLAAHPPF 85 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 48 QRRDWENPGVTQLNRLAAHPPF 69 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 139 QRRDWENPGVTQLNRLAAHPPF 160 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 68 QRRDWENPGVTQLNRLAAHPPF 89 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 44 QRRDWENPGVTQLNRLAAHPPF 65 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 148 QRRDWENPGVTQLNRLAAHPPF 169 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 838 QRRDWENPGVTQLNRLAAHPPF 859 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 21 QRRDWENPGVTQLNRLAAHPPF 42 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 65 QRRDWENPGVTQLNRLAAHPPF 86 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 39 QRRDWENPGVTQLNRLAAHPPF 60 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 78 QRRDWENPGVTQLNRLAAHPPF 99 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 72 QRRDWENPGVTQLNRLAAHPPF 93 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 61 QRRDWENPGVTQLNRLAAHPPF 82 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 74 QRRDWENPGVTQLNRLAAHPPF 95 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 261 QRRDWENPGVTQLNRLAAHPPF 282 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 119 QRRDWENPGVTQLNRLAAHPPF 140 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 55 QRRDWENPGVTQLNRLAAHPPF 76 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 41 QRRDWENPGVTQLNRLAAHPPF 62 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 42 QRRDWENPGVTQLNRLAAHPPF 63 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 106 QRRDWENPGVTQLNRLAAHPPF 127 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 119 QRRDWENPGVTQLNRLAAHPPF 140 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 44 QRRDWENPGVTQLNRLAAHPPF 65 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 25 QRRDWENPGVTQLNRLAAHPPF 46 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 63 QRRDWENPGVTQLNRLAAHPPF 84 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 42 QRRDWENPGVTQLNRLAAHPPF 63 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 39 QRRDWENPGVTQLNRLAAHPPF 60 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 16 QRRDWENPGVTQLNRLAAHPPF 37 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 24 QRRDWENPGVTQLNRLAAHPPF 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 401 QRRDWENPGVTQLNRLAAHPPF 422 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 50 QRRDWENPGVTQLNRLAAHPPF 71 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 59 QRRDWENPGVTQLNRLAAHPPF 80 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 41 QRRDWENPGVTQLNRLAAHPPF 62 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 124 QRRDWENPGVTQLNRLAAHPPF 145 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 60 QRRDWENPGVTQLNRLAAHPPF 81 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 70 QRRDWENPGVTQLNRLAAHPPF 91 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 73 QRRDWENPGVTQLNRLAAHPPF 94 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 419 QRRDWENPGVTQLNRLAAHPPF 440 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 116 QRRDWENPGVTQLNRLAAHPPF 137 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 72 QRRDWENPGVTQLNRLAAHPPF 93 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 61 QRRDWENPGVTQLNRLAAHPPF 82 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 51 QRRDWENPGVTQLNRLAAHPPF 72 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 54 QRRDWENPGVTQLNRLAAHPPF 75 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 166 QRRDWENPGVTQLNRLAAHPPF 187 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 70 QRRDWENPGVTQLNRLAAHPPF 91 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 57 QRRDWENPGVTQLNRLAAHPPF 78 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 93 QRRDWENPGVTQLNRLAAHPPF 114 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 42 QRRDWENPGVTQLNRLAAHPPF 63 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 68 QRRDWENPGVTQLNRLAAHPPF 89 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 47 QRRDWENPGVTQLNRLAAHPPF 68 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 190 QRRDWENPGVTQLNRLAAHPPF 211 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 39 QRRDWENPGVTQLNRLAAHPPF 60 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 45 QRRDWENPGVTQLNRLAAHPPF 66 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 59 QRRDWENPGVTQLNRLAAHPPF 80 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 56 QRRDWENPGVTQLNRLAAHPPF 77 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 39 QRRDWENPGVTQLNRLAAHPPF 60 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 40 QRRDWENPGVTQLNRLAAHPPF 61 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 54 QRRDWENPGVTQLNRLAAHPPF 75 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 44 QRRDWENPGVTQLNRLAAHPPF 65 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 137 QRRDWENPGVTQLNRLAAHPPF 158 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 46 QRRDWENPGVTQLNRLAAHPPF 67 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 89 QRRDWENPGVTQLNRLAAHPPF 110 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 27 QRRDWENPGVTQLNRLAAHPPF 48 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 158 QRRDWENPGVTQLNRLAAHPPF 179 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 345 QRRDWENPGVTQLNRLAAHPPF 366 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 62 QRRDWENPGVTQLNRLAAHPPF 83 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 26 QRRDWENPGVTQLNRLAAHPPF 47 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 52 QRRDWENPGVTQLNRLAAHPPF 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 114 QRRDWENPGVTQLNRLAAHPPF 135 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 91 QRRDWENPGVTQLNRLAAHPPF 112 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 41 QRRDWENPGVTQLNRLAAHPPF 62 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 65 QRRDWENPGVTQLNRLAAHPPF 86 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 299 QRRDWENPGVTQLNRLAAHPPF 320 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 62 QRRDWENPGVTQLNRLAAHPPF 83 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 63 QRRDWENPGVTQLNRLAAHPPF 84 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 21 QRRDWENPGVTQLNRLAAHPPF 42 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 41 QRRDWENPGVTQLNRLAAHPPF 62 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 416 QRRDWENPGVTQLNRLAAHPPF 437 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 100 QRRDWENPGVTQLNRLAAHPPF 121 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 56 QRRDWENPGVTQLNRLAAHPPF 77 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 48 QRRDWENPGVTQLNRLAAHPPF 69 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 98 QRRDWENPGVTQLNRLAAHPPF 119 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 48 QRRDWENPGVTQLNRLAAHPPF 69 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 216 QRRDWENPGVTQLNRLAAHPPF 237 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 48 QRRDWENPGVTQLNRLAAHPPF 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 218 QRRDWENPGVTQLNRLAAHPPF 239 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 38 QRRDWENPGVTQLNRLAAHPPF 59 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 53 QRRDWENPGVTQLNRLAAHPPF 74 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 43 QRRDWENPGVTQLNRLAAHPPF 64 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 48 QRRDWENPGVTQLNRLAAHPPF 69 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 152 QRRDWENPGVTQLNRLAAHPPF 173 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 50 QRRDWENPGVTQLNRLAAHPPF 71 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 40 QRRDWENPGVTQLNRLAAHPPF 61 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 60 QRRDWENPGVTQLNRLAAHPPF 81 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 45 QRRDWENPGVTQLNRLAAHPPF 66 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 80 QRRDWENPGVTQLNRLAAHPPF 101 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 200 QRRDWENPGVTQLNRLAAHPPF 221 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 58 QRRDWENPGVTQLNRLAAHPPF 79 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 37 QRRDWENPGVTQLNRLAAHPPF 58 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 91 QRRDWENPGVTQLNRLAAHPPF 112 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 27 QRRDWENPGVTQLNRLAAHPPF 48 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 54 QRRDWENPGVTQLNRLAAHPPF 75 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 192 QRRDWENPGVTQLNRLAAHPPF 213 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +1 Query: 523 KRCDWENPGVPQLNCLAGHSPF 588 +R DWENPGV QLN LA H PF Sbjct: 34 QRRDWENPGVTQLNRLAAHPPF 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,843,270 Number of Sequences: 59808 Number of extensions: 355401 Number of successful extensions: 3871 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3862 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -