BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0010 (539 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 29 0.58 SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomy... 29 0.58 SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosacc... 26 3.1 SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharom... 25 7.2 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 28.7 bits (61), Expect = 0.58 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 169 ENILSQLLNYIFQSNQILSLMSCACCVKSYV 261 E+I LN+I NQ + M C KSYV Sbjct: 58 EDIFQDFLNFIITKNQEMFSMDCNSICKSYV 88 >SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 802 Score = 28.7 bits (61), Expect = 0.58 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 142 DFKLLCSQGENILSQLLNYIFQSNQILSL 228 D + + SQG N+L+Q LN +Q+ I+SL Sbjct: 437 DLEEIWSQGLNLLTQPLNRFYQARDIVSL 465 >SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 830 Score = 26.2 bits (55), Expect = 3.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -2 Query: 241 MHSSLRTRFDYFEKCNSTIDLRCFHLDCII 152 +HS + R C + DLR HL+C++ Sbjct: 282 IHSDIHVRITNLPTCFTLRDLRQSHLNCLV 311 >SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharomyces pombe|chr 2|||Manual Length = 365 Score = 25.0 bits (52), Expect = 7.2 Identities = 14/57 (24%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +1 Query: 43 HSIKINSKTNVSRKYMSIYQISEC*ILTTQNIVD-FKLLCSQGENILSQLLNYIFQS 210 H I ++++V R ++ ++ IL+TQN+++ ++L + E + ++ LN++ S Sbjct: 93 HIINFAAESSVDRSFIDPLYFTKNNILSTQNLLECVRILLGKKEELRNR-LNFVHVS 148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,022,847 Number of Sequences: 5004 Number of extensions: 38269 Number of successful extensions: 58 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -