BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0010 (539 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78418-4|CAB01698.1| 710|Caenorhabditis elegans Hypothetical pr... 27 6.5 U97008-16|AAB52300.1| 303|Caenorhabditis elegans Serpentine rec... 27 6.5 >Z78418-4|CAB01698.1| 710|Caenorhabditis elegans Hypothetical protein F25D7.5 protein. Length = 710 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 169 ENILSQLLNYIFQSNQILSLMSCACCVKSYVFILTGRLYL 288 ++ ++ NYIF S I SL+SC+ V G++YL Sbjct: 191 DSFFTRFGNYIFDSPTINSLVSCSSTVLLIGVKSVGKIYL 230 >U97008-16|AAB52300.1| 303|Caenorhabditis elegans Serpentine receptor, class sx protein24 protein. Length = 303 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = -3 Query: 150 FKIYYILCS*NLTFTYLVN*HVFSTNVCLRVNFYGMIFIFLNKLLQI 10 F Y + + L L+N V S++ C ++ YG+ + + LL + Sbjct: 52 FNFVYCIYAAQLRVMILINESVMSSSTCFLISIYGIFAMNMQSLLAL 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,991,708 Number of Sequences: 27780 Number of extensions: 209087 Number of successful extensions: 336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1081316076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -