Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    23   2.0  
AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    21   8.1  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 9/13 (69%), Positives = 12/13 (92%)
 Frame = -2

Query: 368 TLKLLPIILNPVV 330
           T+ LLPII+NP+V
Sbjct: 136 TVYLLPIIINPLV 148


>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.1
 Identities = 12/34 (35%), Positives = 16/34 (47%)
 Frame = +3

Query: 453 IEYAFYGFRTNGTGRRIERHFQRNPGHSRYILAL 554
           I YAF G   NGT + I+       G+   + AL
Sbjct: 56  INYAFLGVYPNGTLQMIDEWGDIEKGNFAEVEAL 89


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,544
Number of Sequences: 336
Number of extensions: 3239
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15352827
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)