BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0009 (606 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 27 0.36 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.4 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 25 2.5 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 4.4 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.4 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 27.5 bits (58), Expect = 0.36 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -1 Query: 552 KPEYTLSGPGCVENAFLFFVQFHLFENHKTHTRFYIFKFDSFND 421 K +Y PGC + + F+ LF+N + F F+ N+ Sbjct: 597 KTDYQPRTPGCAPSVLIMFINMMLFKNSEPFHGCDEFMFEGQNE 640 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 112 RQIDKWHGQLFRNIFIFFITDMLGRSQSPPAVKW 213 RQI KW G++ R + IF + R+Q W Sbjct: 2939 RQISKWSGKVKRTVDIFVANMITFRAQLALGRDW 2972 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 24.6 bits (51), Expect = 2.5 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = +2 Query: 452 NRVCVLWFSNKWNWTKNRKAF 514 N W+ + W W RK F Sbjct: 158 NNWVAAWYGSAWEWNDERKQF 178 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.8 bits (49), Expect = 4.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -1 Query: 528 PGCVENAFLFFVQFHLFENHK 466 PGC + + F+ LF+N + Sbjct: 594 PGCAPSVLIMFINMMLFKNQE 614 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 24 GGGGSEMRADRKEWNKKIR 80 GGGG R +EWN + R Sbjct: 532 GGGGGGGREGSQEWNSRSR 550 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,458 Number of Sequences: 2352 Number of extensions: 12959 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -